triangle PDBeMotif: 2cp3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification protein binding    | release date: Thu, May 19, 2005
Title solution structure of the 2nd cap-gly domain in human clip- 115/cyln2
Authors K.SAITO, M.INOUE, RIKEN, S.KOSHIBA, S.YOKOYAMA, STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE (RSGI), T.KIGAWA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSG
PSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | |   |^*****  |           |  | | ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        | |                ********************************           |  | | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |                              | | |   | |****              |  | | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***                              | ***   | |                  |  | | |      
search RasMol script viewer Motif-ligand binding stats  nest ..                                         | |     ***                  |  | | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ***                          **** ***      

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     | |  |        | | || ||^*****  |           |  | | ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..                           ********************************           |  | | | | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             |  |        | ***| || |                  |  | | | | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |        | |  | |***                  |  | | | | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****        ***  ***                     **** *** ***  

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     | |  |        | | |   |^*****  |    | |    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        |  |               ********************************    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |                 |  |        | | |   | |****       | |    |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |                 |  |        | ***   | |           | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |                 |  |        | |     ***           ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                 ****        ***                          ****          

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | || ||^*****  |           |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..                           ********************************           |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                         | | || || |                  ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                         | ***| || |                  |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                         | |  | |***                  |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ***  ***                     ****          

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****  || | |  |        | | |    ^*****  |    | |    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..   | |  | ||     | |    || ********************************    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |  | ||     | |    **   |  |        | | |      |  |       | |    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |  | ||     | |         |  |        | | |      ****       | |    |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   ***  ***|     | |         |  |        | ***                 | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |     | |         |  |        | |                   ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ****     ***         ****        ***                          ****          

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     | |  |        | | |   |^*****  |           |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..    | | |  |               ********************************           |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    *** |  |                 |  |        | ***   | |                  |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |                 |  |        | |     ***                  |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                 ****        ***                          ****          

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |               | |   |^*****  |           |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..                           ********************************           |  |     | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                           | |   | |****              ****     | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                           ***   | |                  |  |     | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                                                 ***                  |  |     | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                      ****     ***  

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |               | |    ^*****  |  |  |     |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..     | |                   ********************************  |  |     |  |     | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |                                   | |               ****     |  |     | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     ***                                   ***                        |  |     ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                      ****          

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | || ||^*****  |           |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..    | | |  |               ********************************           |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | | |  |                             | ***| || |                  |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..    *** |  |                             | |  | |***                  |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                             ***  ***                     ****          

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | |    ^*****  |           |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        |  |               ********************************           |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |                             | | |      ****              ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |                             | ***                        |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                             ***                          ****          

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | |   |^*****  |  | |||    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 .. | |    |  |               ********************************  | |||    |  |     | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |    ****                             | | |   | |****     ****|    |  |     | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |    |  |                             | ***   | |           | |    |  |     ***  
search RasMol script viewer Motif-ligand binding stats  nest .. ***    |  |                             | |     ***           ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                             ***                   ***    ****          

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | ||||   ^*****  |    | |    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..  | |            | |       ********************************    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |            | |                     | ***|                | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..  ***            ***                     | || |                ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ******                ***    ****          

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | |    ^*****  |          || ||  |^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        |  |               ********************************          || ||  | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |                             | | |      ****             ****|  | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |                             | ***                        |  |  ***     
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                             ***                          ****          

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | |      ^*****  |    | |    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..                           ********************************    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                         | |        ****       | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                         | |                   ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ***                          ****          

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | |   |^*****  |    | |    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        | |                ********************************    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |                              | | |   | |****       | |    ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***                              | ***   | |           | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                         | |     ***           ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ***                          ****          

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     | |  |        | | |    ^*****  |    | |    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        | |                ********************************    | |    |  |   | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***                  |  |        | ***                 | |    |  |   ***    
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |        | |                   ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****        ***                   ***    ****          

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     | |  |        | | |   |^*****  |  | |||    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        | |                ********************************  | |||    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |                  |  |        | | |   | |         ****|    |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***                  |  |        | ***   | |           | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |        | |     ***           ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****        ***                          ****          

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     |             | | |   |^*****  |  |  |    || || | ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        |  |               ********************************  |  |    || || | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****                             | | |   | |         ****    ****| | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                         | ***   | |                  |  | | |      
search RasMol script viewer Motif-ligand binding stats  nest ..                                         | |     ***                  |  | | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ***                          **** ***      

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     | |  |        | | |    ^*****  |  | |||    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..     | ||  |               ********************************  | |||    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | ||  |                 |  |        | | |               ****|    |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | ||  |                 |  |        | ***                 | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..     | ||  |                 |  |        | |                   ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..     *******                 ****        ***                          ****          

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CLIP-115
member of: CATH:search2.30.30.190GENE3D:searchG3DSA_2.30.30.190PANTHER:searchPTHR18916/searchPTHR18916_SF10PFAM:searchPF01302PROSITE PATTERNS:searchPS00845, PROSITE PROFILES:searchPS50245, SMART:searchSM01052SUPERFAMILY:searchSSF74924UniProt:searchQ9UDT6
sec str:  ..............eeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeee...eee........
sequence :  ..GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****    ^*****     | |  |        | | |   |^*****  |    | |    |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  CAP_GLY_1 ..        |  |               ********************************    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |                 |  |        | ***   | |           | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |                 |  |        | |     ***           ***    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                 ****        ***                          ****          

   New search    2cp3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML