triangle PDBeMotif: 2coj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.6.1.42
Classification transferase    | release date: Tue, May 17, 2005
Title crystal structure of reduced human cytosolic branched-chain aminotransferase complexed with gabapentin
Authors M.GOTO
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search PLP PLP binding statistics PLP   search GBN GBN binding statistics GBN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLS
LHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASL
YIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTAL
EGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREERDWTIVLS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF29PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchP54687
JMol viewer RasMol script viewer  GBN 420B  ..                        ..                                           *                                                                                    *                   ..GBN ..                                                                                                                                                                                           
JMol viewer RasMol script viewer  GBN 420A  ..                        ..                                           |    *                                                                 *             |                   ..GBN ..                                                             **                                                                      ***                                                   
JMol viewer RasMol script viewer  PLP 410A  ..                        ..                                           |    |                       *                                         |             |                   ..PLP ..             *         *    *                             *  ***                       * ***                                         **|                                                   
sec str:  ......hhhhhee........................eeeeeeee...ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee...........eeeeeeeeeee....... .....eeeee.................hhhhhhhhhhhhhhhhh...eeeeee....eeeee..eeeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhh...eeeeeeee...eeeeeeeeee..eeee..hhhhhhhhhhhhhhhhhhhhh.......eee.
sequence :  ..VGTFKAKDLIVTPATILKEKPDPN..LVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYF... ..FNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREERDWTIVL
seq num:  ..22        32        42  ..47        57        67        77        87        97        107       117       127       137       147       157       167       177       187     ... ..199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || |||||    | |     | |.. | |||  |                      ^***|  |    ||||         | |||                   | |   |   |        |  |  | || ||         | | ||| | ||               ..PS00001..        |  |   |  ||  |||| || |       |  | |         | |  |           | |||        |||||   |||        ||||  | |  || ||||  | | |    |    |                       |   |    |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || |||||    | |     | |.. | |||  |                          |  |    ||||         | |||                   | |   |   |        |  |  | || ||         | | ||| **^*               ..PS00004..        |  |   |  ||  |||| || |       |  | |         | |  |           | |||        |||||   |||        ||||  | |  || ||||  | | |    |    |                       |   |    |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |^**||||    | |     | |.. | |||  |                          |  |    ||||         | |||                   | |   |   |        |  |  | || ||         | | |||                    ..PS00005..        |  |   |  ||  |||| || |       |  | |         | |  |           | |||        |||||   ^**        ||||  ^**  || ||||  | | |    |    |                       |   |    |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |||||    | |     | |.. | |||  |                          |  |    ||||         | |||                   | |   |   |        |  |  | || ||         | | |||                    ..PS00006..        |  |   |  ||  |||| || |       |  | |         | |  |           | |||        |||||    |         ||||       ^***||^*** | |    |    |                       |   |    |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |||||    | |     | |.. | |||  |                          |  |    ||||         | |||                   | |   |   |        ********^| ||         | | |||                    ..PS00007..        |  |   |  ||  |||| || |       |  | |         | |  |           | |||        |||||    |         ||||       ||  ||     | |    |    |                       |   |    ******^||| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****||    | |     | |.. | ^*****                          |  |    ||||         | |||                   | |   |   |           |  |  | ||         ^*****|                    ..PS00008..        |  |   |  ^*****|^*****       |  | |         | |  |           | |||        |||||    |         ||||       ||  ||     | |    ^*****                       |   |          |||| |  |   
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..    || ||    | |     | |.. | |||                             |  |    ||||         | |||                   | |   |   |           |  |  | ||         | | | |                    ..PS00770..        |  |   |  ||  |||| ||         |  | |         | |  ***********************************         ||||       ||  ||     | |                                 |   |          |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    || ||    | |     | |.. | |||                             |  |    ||||         | |||                   | |   *****           |  |  | ||         | | | |                    ..asxmotif..        |  |   |  ||  |||| ||         |  | |         | |  |           | |||        |||||              ||||       ||  ||     | |                                 |   |          |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||    | |     ***.. | |||                             |  |    ||||         | ***                   | |                   |  |  | ||         | | | |                    ..asxturn..        |  |   |  ||  |||| ||         |  | |         | |  |           | |||        |||||              ||||       ||  ||     | |                                 |   |          |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    || ||    | |        .. | |||                             |  |    ||||         | |||                   | |                   |  |  | ||         | | | |                    ..betabulgeloop..        |  |   |  ||  |||| ||         |  | |         | |  |           *****        |||||              ||||       ||  ||     | |                                 |   |          |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|    | |        .. ****|                             ****    ||||         ****|                   | |                   ****  | ||         | | | |                    ..betaturn..        |  |   ****|  ||*****         **** |         | |  |           ****|        |||||              ||||       ||  ||     | |                                 |   |          |||| |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |    | |        ..   | |                             |  |    |***           | |                   | |                   |  |  | ||         | *** |                    ..gammaturn..        |  |       |  ||                 | |         | |  |             | |        |||||              ||||       ||  ||     | |                                 |   |          |||| |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |    | |        ..   ***                             |  |    ***            ***                   ***                   |  |  | ||         | | | |                    ..nest..        |  |       |  ||                 ***         ***  |             ***        ****|              ****       ||  ||     ***                                 |   |          **** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..     ****    ***        ..   ***                             ****                                                               ****  ****         *** ***                    ..niche..        ****       ****|                                  |                            |                         ||  ||     ***                                 |   |               ****   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        ..                                                                                                            | |                                     ..stmotif..                       |                                  |                            |                         *****|                                         |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        ..                                                                                                            | |                                     ..ststaple..                       |                                  |                            |                          *****                                         *****                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ..                                                                                                            ***                                     ..stturn..                       |                                  |                            |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                        ..                                                                                                                                                    ..REP00000..                       *                                  *                            *                                                                                                   

chain B : BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF29PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchP54687
JMol viewer RasMol script viewer  GBN 420B  ..                                                                                                                                         * *                               ..GBN ..                                                             **                                                                      ***                                                   
JMol viewer RasMol script viewer  PLP 410B  ..                                                                                               *                                         | |                               ..PLP ..             *         *    *                             *  ***                       * ***                                         |*|                                                   
JMol viewer RasMol script viewer  MG 430B  ..                                                                                               |             *                           | |                               ..MG ..             |         |    |                             |  |||                       | |||                                         |||                                                   
JMol viewer RasMol script viewer  GBN 420A  ..                                                                  *                            |             |                           | |           *                   ..GBN ..             |         |    |                             |  |||                       | |||                                         |||                                                   
sec str:  ....hhhhhee.......................eeeeeeee...ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee...........eeeeeeeeeee....... .....eeee.................hhhhh..hhhhhhhhhh....eeeeee....eeeee..eeeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhh...eeeeeeee...eeeeeeeee....eee..hhhhhhhhhhhhhhhhhhhhh.......eee.
sequence :  ..TFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYF... ..FNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREERDWTIVL
seq num:  ..24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184        ... ..199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |||||                   | |  |       |   |          ^***|  |    | |          | |||                || |||   | |||        | || || || ||         | | ||| | ||               ..PS00001..        | ||   |  ||  |||| || ||      |  | |         | |  |           | |||        ||||| | |||        ||||  | |  || |||| ||||||||  |    |         | |                  | | |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |||||                   | |  |       |   |              |  |    | |          | |||                || |||   | |||        | || || || ||         | | ||| **^*               ..PS00004..        | ||   |  ||  |||| || ||      |  | |         | |  |           | |||        ||||| | |||        ||||  | |  || |||| ||||||||  |    |         | |                  | | |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**||||                   | |  |       |   |              |  |    | |          | |||                || |||   | |||        | || || || ||         | | |||                    ..PS00005..        | ||   |  ||  |||| || ||      |  | |         | |  |           | |||        ||||| | ^**        ||||  ^**  || |||| ||||||||  |    |         | |                  | | |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |||||                   | |  |       |   |              |  |    | |          | |||                || |||   | |||        | || || || ||         | | |||                    ..PS00006..        | ||   |  ||  |||| || ||      |  | |         | |  |           | |||        ||||| |  |         ||||       ^***||^***||||||  |    |         | |                  | | |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |||||                   | |  |       |   |              |  |    | |          | |||                || |||   | |||        ********^| ||         | | |||                    ..PS00007..        | ||   |  ||  |||| || ||      |  | |         | |  |           | |||        ||||| |  |         ||||       ||  ||  | ||||||  |    |         | |                  | ******^||| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*****||                   ^*****       |   |              |  |    | |          | |||                || |||   | |||          || ||  | ||         ^*****|                    ..PS00008..        | ||   |  ^*****|^*****|      |  | |         | |  |           | |||        ||||| |  |         ||||       ||  ||  | ||||||  ^*****         | |                  |   |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..  || ||                   | |          |   |              |  |    | |          | |||                || |||   | |||          || ||  | ||         | | | |                    ..PS00770..        | ||   |  ||  |||  ||  |      |  | |         | |  ***********************************         ||||       ||  ||  | ||||||                 | |                  |   |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  || ||                   | |          |   |              |  |    | |          | |||                || |||   *****          || ||  | ||         | | | |                    ..alphabetamotif..        | ||   |  ||  |||  ||  |      |  | |         | |  |           | |||        ||||| |            ||||       ||  ||  | ||||||                 | |                  |   |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  || ||                   | |          |   |              |  |    | |          | |||                || |||   *****          || ||  | ||         | | | |                    ..asxmotif..        | ||   |  ||  |||  ||  |      |  | |         | |  |           | |||        ||||| |            ||||       ||  ||  | ||||||                 | |                  |   |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..  || ||                   | |          |   |              |  |    | |          | ***                || |||   ***|           || ||  | ||         | | | |                    ..asxturn..        ***|   |  ||  |||  ||  |      |  | |         | |  |           | |||        ||||| |            ||||       ||  ||  | ||||||                 | |                  |   |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..  || ||                   | |          |   |              |  |    | |          | |||                || |||   |  |           || ||  | ||         | | | |                    ..betabulge..        |  |   |  ||  |||  ||  |      |  | |         | |  |           | |||        ||||| |            ||||       ||  ||  | ||||**                 | |                  |   |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****                   | |          |   |              |  |    | |          ****|                |****|   ****           *****  | ||         | | | |                    ..betaturn..        |  |   ********|********      **** |         | |  |           ****|        ||||| |            ||||       ||  ||  ****||                   | |                  |   |   |||| ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |                   | |          |   |              |  |    | |            | |                |  | |                   |  |  | ||         | | | |                    ..gammaturn..        |  |       |  ||                 | |         | |  |             | |        ||||***            ||||       ||  ||    ||||                   ***                  |   |   |||| |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                   ***          |   |              |  |    ***            ***                |  ***                   |  |  | ||         | | | |                    ..nest..        |  |       |  ||                 ***         ***  |             ***        ****|              ****       ||  ||    ****                                        |   |   **** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                   ***          |   |              ****                                      |    |                   ****  ****         *******                    ..niche..        ****       ****|                                  |                            |                         ||  ||     ***                                        |   |        ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                       |   |                                                        ******                         | |                                     ..schellmannloop..                       |                                  |                            |                         ||  ||                                                |   |               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                       *****                                                                                       | |                                     ..stmotif..                       |                                  |                            |                         *****|                                                |   |               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                   | |                                     ..ststaple..                       |                                  |                            |                          *****                                                *****               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                   ***                                     ..stturn..                       |                                  |                            |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                           ..REP00000..                       *                                  *                            *                                                                                                   

   New search    2coj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors