triangle PDBeMotif: 2ckh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.22.
Classification hydrolase    | release date: Tue, Apr 18, 2006
Title senp1-sumo2 complex
Authors C.DONG, H.LIU, J.H.NAISMITH, L.N.SHEN, R.T.HAY
Method X-RAY DIFFRACTION (resolution: 3.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
EFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFF
TKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKE
FDTNGWQLFSKKSQIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
Chain B sequence:
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SENTRIN-SPECIFIC PROTEASE 1
member of: GENE3D:searchG3DSA_3.30.310.130PANTHER:searchPTHR12606/searchPTHR12606_SF7PFAM:searchPF02902PROSITE PROFILES:searchPS50600, SUPERFAMILY:searchSSF54001UniProt:searchQ9P0U3
sec str:  .......hhhhhhhhhhhhh................hhhhhhh......eehhhhhhhhhhhhhhh.......eee...hhhhhhhhhhhhhhh......hhhhh.eeeeeee....eeeeeee....eeeee......hhhhhhhhhhhhhhhhhhhh.........eeee............hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh...
sequence :  ..EFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
seq num:  ..419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  ||    |  |  | ||| |       | |||| ||   |       |  ||      |  |           |   |  |  |||||||||| ||        ||||| |   |  ||^*** | |||   |           |  ||| |  ||| |   | |     | ^***| |          | |  ^***| |                 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  ||    |  |  | ||| |       | |||| ||   |       |  ||      |  |           |   |  |  |**^*||||| ||        ||||| |   |  ||| |  | |||   |           |  ||| |  ||| |   | |     | ||| | |          | |    ||| |                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  ||    |  |  | ||| |       ^**||| ||   |       |  ||      |  |           |   |  |  | | ^**||| ||        ||||| |   |  ||| |  | |||   |           |  ||| |  ||| |   ^**     | ||| | |          | |    ||| |                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  ||    |  |  | ||| |       ^***|| ||   |       |  ||      |  |           |   |  |  | | || ||| ||        ||||| |   |  ||| ^*** |||   |           |  ||| |  ||| |           | ||| | |          | |    ||| |                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  ||    |  |  | ||| |       |   || ||   |       |  ||      |  |           |   |  |  | | || ||| ||        |^*****   |  |||    | |^*****           |  ||| |  ||| |           | |^*****          | |    ||| |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****    |  |  | ||| |       |   || ||   |       *****      |  |           |   |  |  | | || ||| ||        | |||     |  |||    | | |               *****| |  ||| |           | | | |            | |    ||| |                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     |  |     |  |  | ||| |       |   || ||   |       |  |       |  |           |   |  |  | | || ||| ||        | |||     *****|    | | |               |  | | |  ||| |           | | | |            | |    ||| |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |     |  |  ***|| |       |   || ||   |       |  |       |  |           |   |  |  | | || ||| ||        | |||        | |    | | |               |  | | |  ||| |           | *** |            | |    ||| |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****     |  |  |  || |       |   *****   |       ****       |  |           |   |  **** **** |****|        | |||        | |    | | |               **** | |  ||| |           | |   |            | |    |****                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |  |  |  |***       |   ||  |   |                  |  |           |   |       | || | |  |        ***||        | |    | | |                    | |  ||| |           | |   |            | |    ***                   
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |  |  |          |   ||  |   |                  |  |           |   |       | || | |  |           ||        ***    | ***                    ***  ||| |           ***   |            ***                          
search RasMol script viewer Motif-ligand binding stats  niche ..              ****  ****          |   |****   |                  ****           |   |       ****** ****           ||               |                             *****                 |                                         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  *****       |                                 |   |                             ||               |                                                   |                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                              |                                 *****                             ||               |                                                   |                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                              *                                                                   **               *                                                   *                                         

chain B : SMALL UBIQUITIN-RELATED MODIFIER 2
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ....eeeeeeee...eeeeeeee....hhhhhhhhhhh.......eeeee..ee.....hhhhhh....eeeeeee..ee.
sequence :  ..NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
seq num:  ..14        24        34        44        54        64        74        84       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | | ||     | ||               | |       |   ^*** |  | ||  |           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | | ||     **^*               | |       |    | | |  | ||  |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | | ||     |  |               ^**       |    | | |  | ||  |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         ^*****     |  |                         ^***** | |  | ||  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |      |  |                              | | **** ||  |           
search RasMol script viewer Motif-ligand binding stats  nest ..           ***      |  |                              | |    ***|  |           
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****                              ***       ****           

   New search    2ckh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors