triangle PDBeMotif: 2ce6  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lectin    | release date: Fri, Feb 3, 2006
Title structure of helix pomatia agglutinin with no ligands
Authors A.AUDFRAY, A.IMBERTY, C.BRETON, C.GAUTIER, E.P.MITCHELL, J.-F.SANCHEZ, J.GAGNON, J.LESCAR, V.CHAZALET
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RVQSGKINCGDDAGWAKVPSNDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASC
YTWHNTKVYSMSISWISIENY
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HELIX POMATIA AGGLUTININ
member of: PFAM:searchPF09458SUPERFAMILY:searchSSF141086UniProt:searchQ2F1K8
sec str:  ...eeeeeeee.hhhhheee.........eeeeeeeeee........eeeeeeeeeeee......eeeeeeeee..eeeeeeeee....eeeeeeeeeeee.
sequence :  ..RVQSGKINCGDDAGWAKVPSNDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASCYTWHNTKVYSMSISWISIEN
seq num:  ..1         11        21        31        41        51        61        71        81        91        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |    ||| |      |  |  |     ^*** |            |  | |  |        || | |         | |  ||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**    ||| |      |  |  |        | |            |  | |  |        || | |         | |  ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          ||| |      |  |  |        | |            ^*** |  |        || | |         | |  ||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..          *** |      |  |  |        | |                 |  |        || | |         | |  ||          
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |      |  |  |        | |                 |  |        ** | |         | |  **          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****      |  |  |        | |                 |  |           | |         | |              
search RasMol script viewer Motif-ligand binding stats  niche ..           ****      *******        ***                 ****           | |         ***              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                       ***                          

   New search    2ce6:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors