triangle PDBeMotif: 2c10  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.4.3.6
Classification oxidoreductase    | release date: Fri, Sep 9, 2005
Title the structure of a truncated, soluble version of semicarbazide-sensitive amine oxidase
Authors E.JAKOBSSON, G.J.KLEYWEGT
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search BMA BMA binding statistics BMA   search NAG NAG binding statistics NAG   search CU CU binding statistics CU   search MAN MAN binding statistics MAN   search FUL FUL binding statistics FUL   search CA CA binding statistics CA   search NDG NDG binding statistics NDG   search CL CL binding statistics CL
Modified residues:  search TPQ TPQ binding statistics TPQ
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
GGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAA
ALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNREL
PQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQG
RYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPR
IFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDA
FCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYG
NQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLY
LASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNET
IAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAAC
APDLPAFSHGGFSHN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MEMBRANE COPPER AMINE OXIDASE
member of: CATH:search2.70.98.20/search3.10.450.40GENE3D:searchG3DSA_2.70.98.20/searchG3DSA_3.10.450.40PANTHER:searchPTHR10638/searchPTHR10638_SF23PFAM:searchPF01179/searchPF02727/searchPF02728PRINTS:searchCUDAOXIDASEPROSITE PATTERNS:searchPS01164/searchPS01165, SUPERFAMILY:searchSSF49998/searchSSF54416UniProt:searchQ16853
JMol viewer RasMol script viewer  CL 1778B  .. ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     **                                                                                                                                                                                                          
JMol viewer RasMol script viewer  NAG 1771B  .. ..                                                                                                                                                                                                                                                                                                                                                                                                        *                                                                                                            ||                                                                                                                                                                       *                                  
JMol viewer RasMol script viewer  NAG 1767B  .. ..                                                                                                                                                                                                                                                                                                                                                                                                      **|                                                                                                            ||                                                                                                                                                                       |                                  
JMol viewer RasMol script viewer  CL 1775A  .. ..                                                                                                            *                                                                                                                                                                                                                                                                                         |||                                                                                                            ||                                                                                                                                                                       |                                  
JMol viewer RasMol script viewer  CL 1774A  .. ..                                                                                                            |                                                                                                                                                                                                                        *                                                                |||                                                                                                            ||                                                          *                                                                                                            |                                  
JMol viewer RasMol script viewer  CA 1773A  .. ..                                                                                                            |                                                                                                                                                                                                                        |                                                                |||                                                                                                            ||                                                          |                                           * * *                                                            |                                  
JMol viewer RasMol script viewer  CU 1772A  .. ..                                                                                                            |                                                                                                                                                                                                                        |                                                                |||                                                                     * *                                    ||                                                          |                                           | | |                *                                           |                                  
JMol viewer RasMol script viewer  CA 1771A  .. ..                                                                                                            |                                                                                                                                                                                                                        |                                                                |||                                                                     | |      ***                           ||                                                          |                                           | | |     **         |                                           |                                  
JMol viewer RasMol script viewer  NAG 1770A  .. ..                                                                                                            |                                                                                                                                                                                                                        |                                                                |||                                                                     | |      |||                           ||                                                          |                                           | | |     ||         |                                           |                                  
JMol viewer RasMol script viewer  NAG 1767A  .. ..                                                                                                            |                                       *  *                      *                                                                                                                                                      |                                                                |||                                                                     | |      |||                           ||                                                          |                                           | | |     ||         |                                           |                                  
JMol viewer RasMol script viewer  NAG 1763A  .. ..                                                                                              *             |                                       |  |                      |                                                                                                                                                      |                                                                |||                                                                     | |      |||                           ||                                                          |                                           | | |     ||         |                                           |                                  
JMol viewer RasMol script viewer  NAG 1762A  .. ..                                                                        *  *   * *            |    *     *  |                                       |  |                      |                                                                                                                                                      |                                                                |||                                                                     | |      |||                           ||                                                          |                                           | | |     ||         |                                           |                                  
JMol viewer RasMol script viewer  NAG 1768A  .. ..                                                                        |  |   | |            |    |     |  |                                       |  |                      |                                                             * *                                                                                      |                                                                |||                                                                     | |      |||                           ||                                                          |                                           | | |     ||         |                                           |                                  
JMol viewer RasMol script viewer  FUL 1766A  .. ..                                                                        |  |   | |            |    |     |  |                                       |  |                      |                                                             | |                                                                                      |                                                                |||                                                                     | |      |||                           ||                                                          |                                           | | |     ||         |                                           |                                  
JMol viewer RasMol script viewer  NDG 1764A  .. ..                                                                        |  |   | |            |    |     |  |                                       |  |                      |                                                             | |                                                                                      |                                                                |||                                                                     | |      |||                           ||                               *                          |                                           | | |     ||         |                                           |                                  
sec str:  ...........hhhhhhhhhhhhhhhh.....hhhhh....eeeeeeeee..hhhhhhhhhhhh......eeeeeeee......eeeeeeee......eeeehhhhhhh..ee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeee............eeeeeeee.....hhhh.eeeeeeeee....hhhhheeeeeee..eee.hhhhhhhhhhh..............................eee...........................................................hhhhhh.....hhh...................eeeeeeeee.....eeeeeeeeeeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeeee............................eee........eeeee..eeee.....................................................hhhhh............................................hhhhhhhh..............................hhhhhh......................hhhhh......................hhhhhh.....................hhhhhh................
sequence :  ..C..QLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSH
seq num:  ..41..58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ..|  |  |  ||   |   | | | ||  || ||  |   ||                | |                   ^***     | |           | |   |  |                  |  |       | ||  || |        | |  |     |   ^***|      | |     | | ||  |                       ||||       ^***| || || |                    | |  | ||                 ||  |   |  |  |      |   || ||| || |  ||  |   ||||| || ||  |   |  |    | ||||     ||||      | |      |    ||        | | |        | |                 | | | |   || | |    |           | |              |  |  |       | |    || || |  | | |     |^***|| |                | ^***|  | || |    | |        | |||        ||| |||^***|        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ..|  |  |  ||   |   ^** | ||  || ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |        | |  |     |    |  |      | |     | | ||  |                       ||||        |  | |^**| |                    | |  | ||                 ||  |   |  |  |      |   || ^** || |  ||  |   ||||| || ||  |   |  |    ^**|||     ||||      | |      |    ||        | | |        | |                 | ^** |   || | |    |           | |              |  |  |       ^**    || || |  | ^**     | |^**| |                |  |  |  | || |    ^**        | |||        ||| ||| || |        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ..|  |  ^***|   |   |   | ||  || ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |        | |  |     |    |  |      | |     | | ||  |                       ||||        |  | || || |                    | |  | ||                 ||  |   |  ^***      |   ||  |  || |  ||  |   ||||| || |^***   |  |    ^***||     ||||      | |      |    ||        | | |        | |                 | |   |   || | |    |           | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||        ||| ||| || |        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. ..|  |  |   |   |   |   | ||  || ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |        | |  |     |    |  |      | |     | | ||  |                       ||||        |  | || || |                    | |  | ||                 ********^            |   ||  |  || |  ||  |   |******^ |       |  |       |||     ||||      | |      |    ||        | | |        | |                 | |   |   || | |    |           | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||        ||| ||| || |        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ..|  |  |   |   |   |   | ^***** ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |        ^*****     ^*****  |      | |     | | ||  |                       ||||        ^*****| || |                    ^***** ||                  |  |                ^*****  |  || |  ||  |   | ||| |  |       |  |       |||     ||||      | |      ^*****|        | | |        | |                 | |   ^***** | ^*****           | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||        ||| ||| || |        |    |   |  ||  | |^*****     | |  | |  | ||   | |||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  RGD .. ..|  |  |   |   |   |   |  |  |  ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |          |  |          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  | ||                  |  |                    ||  |  || |  ||  |   | ||| |  |       |  |       |||     ||||      | |            |        | | |        | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||        ||| ||| || |        |    |   |  ||  | || |        | |  | |  | ||   ***||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_1 .. ..|  |  |   |   |   |   |  |  |  ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |          |  |          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  | ||                  |  |                    ||  |  || |  ||  |   | ||| |  |       |  |       |||     ||||      | |            ***********^**        | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||        ||| ||| || |        |    |   |  ||  | || |        | |  | |  | ||   |  ||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_2 .. ..|  |  |   |   |   |   |  |  |  ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |          |  |          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  | ||                  |  |                    ||  |  || |  ||  |   | ||| |  |       |  |       |||     ||||      | |                     | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||        ||| ||| || |        *****^********  | || |        | |  | |  | ||   |  ||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  asxturn .. ..|  |  |   |   |   |   |  |  |  ||  |   ||                | |                            | |           | |   |  |                  |  |       | ||  || |          |  |          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  | ||                  |  |                    ||  |  || |  ||  |   | ||| |  |       |  |       |||     ***|      | |                     | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||        *** ||| || |                 |  |   | || |        | |  ***  | ||   |  ||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  betabulge .. ..|  |  |   |   |   |   |  |  |  ||  |   **                | |                            | |           | |   |  |                  |  |       | ||  || |          |  |          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  | ||                  |  |                    ||  |  || |  ||  |   | ||| |  |       |  |       |**      | |      | |                     | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  |  |  | || |               | |||         || ||| || |                 |  |   | || |        | |    |  | ||   |  ||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn .. ..|  |  |   |   |   |   |  |  |  ||  |                     | |                            | |           | |   |  |                  ****       | |****| |          ****          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  | ||                  ****                    |****  ****  |****   ****| |  |       |  |       | |      | |      | |                     | |          | |                 | |       |  |                  | |              *******              ****| |  |         | |   | |                |  ****  **** |               ****|         ****|| || |                 |  |   | || |        | |    |  | ||   |  |****           |  |              
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ..|  |  |   |   |   |   |  |  |  ||  |                     | |                            | |           | |   |  |                             | |    | |          |  |          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  | ||                                          ||  |   |    ||  |     | | |  |       |  |       | |      | |      | |                     | |          | |                 ***       |  |                  | |                 |  |               |  | |  |         | |   | |                |  |       |  |               | | |          |  || || |                 |  |   | || |        | |    |  | ||   |  ||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  nest .. ..|  |  |   |   |   |   |  |  |  ||  |                     ***                            | |           ***   |  |                             ***    | |          |  |          |  |      ***     | | ||  |                       ****           |  | || |                    | |  | ||                                          ||  |   |    ||  |     *** |  |       |  |       ***      ***      | |                     | |          ***                           |  |                  | |                 |  |               |  | |  |         | |   ***                |  |       |  |               | | |          |  || || |                 |  |   | |***        ***    |  | ||   |  ||  |           |  |              
search RasMol script viewer Motif-ligand binding stats  niche .. ..****  |   |   |   |   ****  ********                                                    ***                 ****                                    ***          ****          ****              *********                        ***           *********                    ***  ****                                          |****   |    |****         ****       ****                         | |                     ***                                        ****                  ***                 ****               **** ****         ***                      ****       ****               | | |          **********                 ****   ******               *******   ********           ****              
search RasMol script viewer Motif-ligand binding stats  stmotif .. ..      *****   |   |                                                                                                                                                                                                                                | || |                         | |                                           |   |   |    |   |                                                 | |                                                                                                                                                                                                      *****                 | |                                                | |                                         
search RasMol script viewer Motif-ligand binding stats  ststaple .. ..              *****                                                                                                                                                                                                                                | || |                         | |                                           *****   |    *****                                                 | |                                                                                                                                                                                                      | |                   | |                                                | |                                         
search RasMol script viewer Motif-ligand binding stats  stturn .. ..                                                                                                                                                                                                                                                   ******                         ***                                                   |                                                          ***                                                                                                                                                                                                      ***                   ***                                                ***                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site .. ..                                                                                                                                                                                                                                                                                                                                        *                                                                                                                                                                                                                                                                                                                                                                                        

chain B : MEMBRANE COPPER AMINE OXIDASE
member of: CATH:search2.70.98.20/search3.10.450.40GENE3D:searchG3DSA_2.70.98.20/searchG3DSA_3.10.450.40PANTHER:searchPTHR10638/searchPTHR10638_SF23PFAM:searchPF01179/searchPF02727/searchPF02728PRINTS:searchCUDAOXIDASEPROSITE PATTERNS:searchPS01164/searchPS01165, SUPERFAMILY:searchSSF49998/searchSSF54416UniProt:searchQ16853
JMol viewer RasMol script viewer  CL 1779B  ..    ..                                                                                                            *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CL 1778B  ..    ..                                                                                                            |                                                                                                                                                                                                                        *                                                                                                                                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  CA 1777B  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                                                                            *                                                                                          * * *                                                                                               
JMol viewer RasMol script viewer  CU 1776B  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        * *                                                 |                                                                                          | | |                *                                                                              
JMol viewer RasMol script viewer  CA 1775B  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        | |      ***                                        |                                                                                          | | |     **         |                                                                              
JMol viewer RasMol script viewer  NDG 1764B  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        | |      |||                                        |                   *                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  FUL 1766B  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        | |      |||                                        |                   |                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1767B  ..    ..                                                                                                            |                                       *  *                      * *                                                                                                                                                    |                                                                                                                                        | |      |||                                        |                   |                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1770B  ..    ..                                                                                                            |                                       |  |                      | |                                                                                                                                                    |                                                                                                                                        | |      |||                                        |                   |                                                                      | |*|     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1763B  ..    ..                                                                                              *             |                                       |  |                      | |                                                                                                                                                    |                                                                                                                                        | |      |||                                        |                   |                                                                      | |||     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1762B  ..    ..                                                                        *  *   * *            |    *        |                                       |  |                      | |                                                                                                                                                    |                                                                                                                                        | |      |||                                        |                   |                                                                      | |||     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1768B  ..    ..                                                                        |  |   | |            |    |        |                                       |  |                      | |                                                           *                                                                                        |                                                                                                                                        | |      |||                                        |                   |                                                                      | |||     ||         |                                                                              
JMol viewer RasMol script viewer  CL 1774A  ..    ..                                                                        |  |   | |            |    |        |                                       |  |                      | |                                                           |                                                                                        |                                                                                                                                        | |      |||                            *           |                   |                                                                      | |||     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1770A  ..    ..                                                                        |  |   | |            |    |        |                                       |  |                      | |                                                           |                                                                                        |                                                                  *                                                                     | |      |||                            |           |                   |                                                                      | |||     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1767A  ..    ..                                                                        |  |   | |            |    |        |                                       |  |                      | |                                                           |                                                                                        |                                                                * |                                                                     | |      |||                            |           |                   |                                                                      | |||     ||         |                                                                              
sec str:  ..............hhhhhhhhhhhhhhhh.....hhhhh....eeeeeeeee..hhhhhhhhhhhh.....eeeeeeeee......eeeeeeeeee....eeeehhhhhhh..ee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeee............eeeeeeee.....hhhh.eeeeeeeee....hhhhheeeeeee..eee.hhhhhhhhhhh..............................eee...........................................................hhhhhh.....hhh...................eeeeeeeee.....eeeeeeeeeeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeeee............................eee........eeeee..eeee.....................................................hhh..............................................hhhhhhhh..............................hhhhhh......................hhhhh......................hhhhhh...........................................
sequence :  ..PHCP..QLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSH
seq num:  ..39  ..58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    .. | |  || | |  |   | | | ||  || ||  |   ||                | |                   ^***                   | |   |  |                  |  |       | |  | | |        | |  |     |   ^***       | |     | | ||  |      |  |             ||||       ^***| || || |          |  |      | |  | ||                 ||  |   |  | ||      |   || |||  |  ||||  |    || |||| ||  |           | || |     ||||      ||| |    |    ||        | | |        | |                   | | |   || | |    |           | |              |  |  |       | | | ||| || |  | | |     |^***||||                | ^***     |  |||  | ||  |    | ||| | |      |  ||^***| |      |    |   |  ||  | || |  |     | |  | |  | ||   | |||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    .. | |  || | |  |   ^** | ||  || ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |        | |  |     |    |         | |     | | ||  |      |  |             ||||        |  | |^**| |          |  |      | |  | ||                 ||  |   |  | ||      |   || ^**  |  ||||  |    || |||| ||  |           ^**| |     ||||      ||| |    |    ||        | | |        | |                   ^** |   || | |    |           | |              |  |  |       ^** | ||| || |  | ^**     | |^**|||                |  | |     |  |||  ^**|  |    | ||| | |      |  || |||| |      |    |   |  ||  | || |  |     | |  | |  | ||   | |||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    .. | |  ^*** |  |   |   | ||  || ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |        | |  |     |    |         | |     | | ||  |      |  |             ||||        |  | || || |          |  |      | |  | ||                 ||  |   |  ^***      |   ||  |   |  ||||  |    || |||| |^***           ^*** |     ||||      ||| |    |    ||        | | |        | |                       |   || | |    |           | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |||     |  |    | ||| | |      |  || |||| |      |    |   |  ||  | || |  |     | |  | |  | ||   | |||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    .. | |   |   |  |   |   | ||  || ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |        | |  |     |    |         | |     | | ||  |      |  |             ||||        |  | || || |          |  |      | |  | ||                 ********^    ||      |   ||  |   |  ||||  |    ******^ |                  | |     ||||      ||| |    |    ||        | | |        | |                       |   || | |    |           | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |||     |  |    | ||| | |      |  || |||| |      |    |   |  ||  | || |  |     | |  | |  | ||   | |||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    .. | |   |   |  |   |   | ^***** ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |        ^*****     ^*****         | |     | | ||  |      |  |             ||||        ^*****| || |          |  |      ^***** ||                  |  |        ||      ^*****  |   |  ||||  |     | |||  |                  | |     ||||      ||| |    ^*****|        | | |        | |                       ^***** | ^*****           | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |||     |  |    | ||| | |      |  || |||| |      |    |   |  ||  | |^*****     | |  | |  | ||   | |||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  RGD ..    .. | |   |   |  |   |   |  |  |  ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |          |  |                    | |     | | ||  |      |  |             ||||           |  | || |          |  |      | |  | ||                  |  |        ||          ||  |   |  ||||  |     | |||  |                  | |     ||||      ||| |          |        | | |        | |                           |  |                  | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |||     |  |    | ||| | |      |  || |||| |      |    |   |  ||  | || |        | |  | |  | ||   ***||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_1 ..    .. | |   |   |  |   |   |  |  |  ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |          |  |                    | |     | | ||  |      |  |             ||||           |  | || |          |  |      | |  | ||                  |  |        ||          ||  |   |  ||||  |     | |||  |                  | |     ||||      ||| |          ***********^**        | |                           |  |                  | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |||     |  |    | ||| | |      |  || |||| |      |    |   |  ||  | || |        | |  | |  | ||   |  ||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_2 ..    .. | |   |   |  |   |   |  |  |  ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |          |  |                    | |     | | ||  |      |  |             ||||           |  | || |          |  |      | |  | ||                  |  |        ||          ||  |   |  ||||  |     | |||  |                  | |     ||||      ||| |                   | |          | |                           |  |                  | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |||     |  |    | ||| | |      |  || |||| |      *****^********  | || |        | |  | |  | ||   |  ||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    .. | |   |   |  |   |   |  |  |  ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |          |  |                    | |     | | ||  |      |  |             ||||           |  | || |          |  |      | |  | ||                  |  |        ||          ||  |   *****||  |     | |||  |                  | |     ||||      ||| |                   | |          | |                           |  |                  | |              |  |  |           | |***** |  |         | | | |||                |  | |     |  |||     |  |    | ||| | |      |  || |||| |               |  |   | || |        | |  | |  | ||   |  ||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..    .. | |   |   |  |   |   |  |  |  ||  |   ||                | |                                          | |   |  |                  |  |       | |  | | |          |  |                    | |     | | ||  |      |  |             ||||           |  | || |          |  |      | |  | ||                  |  |        ||          ||  |   |  | ||  |     | |||  |                  | |     ***|      ||| |                   | |          | |                           |  |                  | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |||     |  |    | ||| ***      |  || |||| |               |  |   | || |        | |  ***  | ||   |  ||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  betabulge ..    .. | |   |   |  |   |   |  |  |  ||  |   **                | |                                          | |   |  |                  |  |       | |  | | |          |  |                    | |     | | ||  |      |  |             ||||           |  | || |          |  |      | |  | ||                  |  |        **          ||  |   |  | ||  |     | |||  |                  | |      | |      ||| |                   | |          | |                           |  |                  | |              |  |  |           | ||| || |  |         | | | |||                |  | |     |  |**     |  |    | |||          |  || |||| |               |  |   | || |        | |    |  | ||   |  ||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    .. | |   |   |  |   |   |  |  |  ||  |                     | |                                          | |   |  |                  |  |       | |  | | |          |  |                    | |     | | ||  |      |  |             ||||           |  | || |          |  |      | |  | ||                  |  |                    ||  |   |  | ||  |     | |||  |                  | |      | |      ||| |                   | |          | |                           |  |                  | |              |  |  |           | ||| || |  |         | | *****                |  | |     |  |       |  |    | |||          |  || |||| |               |  |   | || |        | |    |  | ||   |  ||  ||  |  |     | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..    .. | |   |   |  |   |   |  |  |  ||  |                     | |                                          | |   |  |                  ****       | |  | | |          ****                    | |     | | |****      ****             ||||           |  | || |          ****      | |  | ||                  ****                    ||  |   **** |****     | |||  |                  | |      | |      ||| |                   | |          | |                           |  |                  | |              *******           | |****| |  |         | | ****|                |  | |     |  |       ****    ****|          |  || |||| |               ****   | || |        | |    **** ||   |  ||  ||  ****     | |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    .. | |   |   |  |   |   |  |  |  ||  |                     | |                                          | |   |  |                             | |  *** |          |  |                    | |     | | ||  |                       ||||           |  | || |                    | |  | ||                                          ||  |   |    ||  |     | |||  |                  | |      | |      ||| |                   | |          | |                           |  |                  | |                 |  |           | | |  | |  |         | |   | |                |  | |     |  |               | | |          |  |***||| |               |  |   | || |        | |    |  | ||   |  ||  ||  |        | |              
search RasMol script viewer Motif-ligand binding stats  nest ..    .. | |   |   |  |   |   |  |  |  ||  |                     ***                                          ***   |  |                             ***    ***          |  |                    ***     | | ||  |                       ****           |  | || |                    | |  | ||                                          ||  |   |    ||  |     ***||  |                  ***      ***      ||| |                   | |          ***                           |  |                  | |                 |  |           | | |  | |  |         | |   ***                |  | |     |  |               | | |          |  |   ||| |               |  |   | |***        ***    |  | ||   |  ||  ||  |        | |              
search RasMol script viewer Motif-ligand binding stats  niche ..    .. ***   |   |  |   |   ****  ********                                                                        ****                                    ***          ****                            *********                                      *********                    ***  ****                                          |****   |    |****     ********                                    *****                   ***          | |                           ****                  ***                 ****           *** **** ****         ***                      **** |     ****               | | |          ****   *****               ****   ******        ***    *******   ************        ***              
search RasMol script viewer Motif-ligand binding stats  stmotif ..    ..       |   |  |   |                                                                                                                                                                                                                                | |                            | |                                           |   |   |    |   |                                                                                      | |                                                                                                          | |                         | |                        *****                 | |                                                | |                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..    ..       *****  *****                                                                                                                                                                                                                                | |                            | |                                           *****   |    *****                                                                                      | |                                                                                                          | |                         | |                        | |                   | |                                                | |                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..    ..                                                                                                                                                                                                                                                   ***                            ***                                                   |                                                                                               ***                                                                                                          ***                         ***                        ***                   ***                                                ***                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..    ..                                                                                                                                                                                                                                                                                                                                        *                                                                                                                                                                                                                                                                                                                                                                                        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : MEMBRANE COPPER AMINE OXIDASE
member of: CATH:search2.70.98.20/search3.10.450.40GENE3D:searchG3DSA_2.70.98.20/searchG3DSA_3.10.450.40PANTHER:searchPTHR10638/searchPTHR10638_SF23PFAM:searchPF01179/searchPF02727/searchPF02728PRINTS:searchCUDAOXIDASEPROSITE PATTERNS:searchPS01164/searchPS01165, SUPERFAMILY:searchSSF49998/searchSSF54416UniProt:searchQ16853
JMol viewer RasMol script viewer  CL 1779D  .. ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      *                                                                                                                                                                                                          
JMol viewer RasMol script viewer  NAG 1771D  .. ..                                                                                                                                                                                                                                                                                                                                                                                                        *                                                                                                             |                                                                                                                                                                     *                                    
JMol viewer RasMol script viewer  NAG 1767D  .. ..                                                                                                                                                                                                                                                                                                                                                                                                      * |                                                                                                             |                                                                                                                                                                     |                                    
JMol viewer RasMol script viewer  CL 1775C  .. ..                                                                                                            **                                                                                    *                                                                                                                                                                                                   | |                                                                                                             |                                                                                                                                                                     |                                    
JMol viewer RasMol script viewer  CL 1774C  .. ..                                                                                                            ||                                                                                    |                                                                                                                                  *                                                                | |                                                                                                             |                                                                                                                                                                     |                                    
JMol viewer RasMol script viewer  CA 1773C  .. ..                                                                                                            ||                                                                                    |                                                                                                                                  |                                                                | |                                                                                                             |           *                                                                                          * * *                                                          |                                    
JMol viewer RasMol script viewer  CU 1772C  .. ..                                                                                                            ||                                                                                    |                                                                                                                                  |                                                                | |                                                                     * *                                     |           |                                                                                          | | |                *                                         |                                    
JMol viewer RasMol script viewer  CA 1771C  .. ..                                                                                                            ||                                                                                    |                                                                                                                                  |                                                                | |                                                                     | |      ***                            |           |                                                                                          | | |     **         |                                         |                                    
JMol viewer RasMol script viewer  NAG 1770C  .. ..                                                                                                            ||                                                                                    |                                                                                                                                  |                                                                | |                                                                     | |      |||                            |           |                                                                                          | | |     ||         |                                         |                                    
JMol viewer RasMol script viewer  NAG 1767C  .. ..                                                                                                            ||                                         *                      * *                 |                                                                                                                                  |                                                                | |                                                                     | |      |||                            |           |                                                                                          | | |     ||         |                                         |                                    
JMol viewer RasMol script viewer  BMA 1769C  .. ..                                                                                                            ||                                         |                      | |                 |                                                                                                                                  |                                                                | |                                                                     | |      |||                            |           |                                                                                          | | |     ||         |                                         |                                    
JMol viewer RasMol script viewer  NAG 1763C  .. ..                                                                                              * *           ||                                         |                      | |                 |                                                                                                                                  |                                                                | |                                                                     | |      |||                            |           |                                                                                          | | |     ||         |                                         |                                    
JMol viewer RasMol script viewer  NAG 1762C  .. ..                                                                        *  *   * *            | |  *        ||                                         |                      | |                 |                                                                                                                                  |                                                                | |                                                                     | |      |||                            |           |                                                                                          | | |     ||         |                                         |                                    
JMol viewer RasMol script viewer  NAG 1768C  .. ..                                                                        |  |   | |            | |  |        ||                                         |                      | |                 |                                         *                                                                                        |                                                                | |                                                                     | |      |||                            |           |                                                                                          | | |     ||         |                                         |                                    
JMol viewer RasMol script viewer  FUL 1766C  .. ..                                                                        |  |   | |            | |  |        ||                                         |                      | |                 |                                         |                                                                                        |                                                                | |                                                                     | |      |||                            |           |                                                                                          | | |     ||         |                                         |                                    
JMol viewer RasMol script viewer  NDG 1764C  .. ..                                                                        |  |   | |            | |  |        ||                                         |                      | |                 |                                         |                                                                                        |                                                                | |                                                                     | |      |||                            |           |                   *                                                                      | | |     ||         |                                         |                                    
sec str:  ...........hhhhhhhhhhhhhhhh.....hhhhh....eeeeeeeee..hhhhhhhhhhh.......eeeeeeee......eeeeeeee......eeeehhhhhhh..ee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeee............eeeeeeee.....hhhh.eeeeeeeee....hhhhheeeeeee..eee.hhhhhhhhhhh..............................eee...........................................................hhhhhh.....hhh...................eeeeeeeee.....eeeeeeeeeeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeeee............................eee........eeeee..eeee.....................................................hhhhh............................................hhhhhhhh..............................hhhhhh......................hhhhh......................hhhhhh.....................hhhhhh................
sequence :  ..C..QLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSH
seq num:  ..41..58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ..|  |  || | |      | | | ||   |  |  |   ||                | |                   ^***             | |   | |   |  |                        |  ||| ||  |           | |  |     |   ^***|      | |     | | || ||                     | ||||       ^***| || || |                    | |  |  |                 ||  | |||  | ||      | | || ||| || |  ||  |   ||||| || ||  |           | ||||     ||||      | |      |    ||        | | |        | |                   | | |   || | |    |           | |              |  |  |       | |     |  | |  | | |     |^***|| |                | ^***  || || |    | ||  |    | |          ||| |||^***|        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ..|  |  || | |      ^** | ||   |  |  |   ||                | |                                    | |   | |   |  |                        |  ||| ||  |           | |  |     |    |  |      | |     | | || ||                     | ||||        | || |^**| |                    | |  |  |                 ||  | |||  | ||      | | || ^** || |  ||  |   ||||| || ||  |           ^**|||     ||||      | |      |    ||        | | |        | |                   ^** |   || | |    |           | |              |  |  |       ^**     |  | |  | ^**     | |^**| |                |  | |  || || |    ^**|  |    | |          ||| ||| || |        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ..|  |  ^*** |          | ||   |  |  |   ||                | |                                    | |   | |   |  |                        |  ||| ||  |           | |  |     |    |  |      | |     | | || ||                     | ||||        | || || || |                    | |  |  |                 ||  | |||  ^***      | | ||  |  || |  ||  |   ||||| || |^***           ^***||     ||||      | |      |    ||        | | |        | |                       |   || | |    |           | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          ||| ||| || |        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. ..|  |   |   |          | ||   |  |  |   ||                | |                                    | |   | |   |  |                        |  ||| ||  |           | |  |     |    |  |      | |     | | || ||                     | ||||        | || || || |                    | |  |  |                 ********^    ||      | | ||  |  || |  ||  |   |******^ |                  |||     ||||      | |      |    ||        | | |        | |                       |   || | |    |           | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          ||| ||| || |        |    |   |  ||  | || |  |     | |  | |  | ||   | |||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ..|  |   |   |          | ^*****  |  |   ||                | |                                    | |   | |   |  |                        |  ||| ||  |           ^*****     ^*****  |      | |     | | || ||                     | ||||        ^*****| || |                    ^*****  |                  |  | ||     ||      ^*****  |  || |  ||  |   | ||| |  |                  |||     ||||      | |      ^*****|        | | |        | |                       ^***** | ^*****           | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          ||| ||| || |        |    |   |  ||  | |^*****     | |  | |  | ||   | |||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  RGD .. ..|  |   |   |          |  |      |  |   ||                | |                                    | |   | |   |  |                        |  ||| ||  |             |  |          |  |      | |     | | || ||                     | ||||          || || || |                    | |  |  |                  |  | ||     ||      | | ||  |  || |  ||  |   | ||| |  |                  |||     ||||      | |            |        | | |        | |                           |  |                  | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          ||| ||| || |        |    |   |  ||  | || |        | |  | |  | ||   ***||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_1 .. ..|  |   |   |          |  |      |  |   ||                | |                                    | |   | |   |  |                        |  ||| ||  |             |  |          |  |      | |     | | || ||                     | ||||          || || || |                    | |  |  |                  |  | ||     ||      | | ||  |  || |  ||  |   | ||| |  |                  |||     ||||      | |            ***********^**        | |                           |  |                  | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          ||| ||| || |        |    |   |  ||  | || |        | |  | |  | ||   |  ||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_2 .. ..|  |   |   |          |  |      |  |   ||                | |                                    | |   | |   |  |                        |  ||| ||  |             |  |          |  |      | |     | | || ||                     | ||||          || || || |                    | |  |  |                  |  | ||     ||      | | ||  |  || |  ||  |   | ||| |  |                  |||     ||||      | |                     | |          | |                           |  |                  | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          ||| ||| || |        *****^********  | || |        | |  | |  | ||   |  ||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ..|  |   |   |          |  |      |  |   ||                | |                                    | |   | |   |  |                        *****| ||  |             |  |          |  |      | |     | | || ||                     | ||||          ***** || |                    | |  |  |                  |  | ||     ||      | | ||  |  || |  ||  |   | ||| |  |                  |||     ||||      | |                     | |          | |                           |  |                  | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          ||| ||| || |                 |  |   | || |        | |  | |  | ||   |  ||  |   | |    |  |               
search RasMol script viewer Motif-ligand binding stats  asxturn .. ..|  |   |   |          |  |      |  |   ||                | |                                    ***   | |   |  |                        |  | | ||  |             |  |          |  |      | |     | | || ||                     | ||||          || || || |                    | |  |  |                  |  | ||     ||      | | ||  |  || |  ||  |   | ||| |  |                  |||     ***|      | |                     | |          | |                           |  |                  | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |          *** ||| || |                 |  |   | || |        | |  ***  | ||   |  ||  |   ***    |  |               
search RasMol script viewer Motif-ligand binding stats  betabulge .. ..|  |   |   |          |  |      |  |   **                | |                                          | |   |  |                        |  | | ||  |             |  |          |  |      | |     | | || ||                     | ||||          || || || |                    | |  |  |                  |  | **     **      | | ||  |  || |  ||  |   | ||| |  |                  |**      | |      | |                     | |          | |                           |  |                  | |              |  |  |               |  | |  |         | |   | |                |  | |  || || |       |  |    | |           || ||| || |                 |  |   | || |        | |    |  | ||   |  ||  |          |  |               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ..|  |   |   |          |  |      |  |                     | |                                          | |   ****                        **** | ||  |             ****          |  |      | |     | | ****|                     ****||          ****| || |                    | |  |  |                  ****                | | |****  ****  |****   ****| |  |                  | |      | |      | |                     | |          | |                           |  |                  | |              *******               |  | ****         | |   | |                |  | ******** |       ****    | |           ****|| || |                 |  |   | || |        | |    |  | ||   |  ||  |          ****               
search RasMol script viewer Motif-ligand binding stats  nest .. ..|  |   |   |          |  |      |  |                     ***                                          ***   |  |                             ***|  |             |  |          |  |      ***     | |  |  |                       ****           |  | || |                    | |  |  |                                      | | ||  |   |    ||  |     *** |  |                  ***      ***      | |                     | |          ***                           |  |                  | |                 |  |               |  | |  |         | |   ***                |  | |     |  |               | |            |  || || |                 |  |   | |***        ***    |  | ||   |  ||  |                             
search RasMol script viewer Motif-ligand binding stats  niche .. ..****   |   |          ****      ****                                                                        ****                                ****             ****          ****              ***  ****                        ***           *********                    ***  ****                                      *** |****   |    |****         ****                                    ***                     ***          | |                           ****                  ***                 ****               **** ****         ***                      **** |     ****               | |            **********                 ****   ******        ***    *******   ********                             
search RasMol script viewer Motif-ligand binding stats  ststaple .. ..       *****                                                                                                                                                                                                                                                                                                                    *****   |    *****                                                                                      | |                                                                                                                                      | |                        | |                   | |                                                | |                                         
search RasMol script viewer Motif-ligand binding stats  stturn .. ..                                                                                                                                                                                                                                                                                                                                        |                                                                                               ***                                                                                                                                      ***                        ***                   ***                                                ***                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site .. ..                                                                                                                                                                                                                                                                                                                                        *                                                                                                                                                                                                                                                                                                                                                                                        

chain D : MEMBRANE COPPER AMINE OXIDASE
member of: CATH:search2.70.98.20/search3.10.450.40GENE3D:searchG3DSA_2.70.98.20/searchG3DSA_3.10.450.40PANTHER:searchPTHR10638/searchPTHR10638_SF23PFAM:searchPF01179/searchPF02727/searchPF02728PRINTS:searchCUDAOXIDASEPROSITE PATTERNS:searchPS01164/searchPS01165, SUPERFAMILY:searchSSF49998/searchSSF54416UniProt:searchQ16853
JMol viewer RasMol script viewer  CL 1780D  ..    ..                                                                                                            *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CL 1779D  ..    ..                                                                                                            |                                                                                                                                                                                                                        *                                                                                                                                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  CA 1778D  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                                                                            *                                                                                          * * *                                                                                               
JMol viewer RasMol script viewer  CU 1777D  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        * *                                                 |                                                                                          | | |                *                                                                              
JMol viewer RasMol script viewer  CA 1776D  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        | |      ***                                        |                                                                                          | | |     **         |                                                                              
JMol viewer RasMol script viewer  NDG 1764D  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        | |      |||                                        |                   *                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  FUL 1766D  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        | |      |||                                        |                   |                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1763D  ..    ..                                                                                                            |                                                                                                                                                                                                                        |                                                                                                                                        | |      |||                                        |                   |                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1762D  ..    ..                                                                        *  *   * *                 *        |                                                                                                                                                                                                                        |                                                                                                                                        | |      |||                                        |                   |                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1767D  ..    ..                                                                        |  |   | |                 |        |                                       *  *                      * *                                                                                                                                                    |                                                                                                                                        | |      |||                                        |                   |                                                                      | | |     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1770D  ..    ..                                                                        |  |   | |                 |        |                                       |  |                      | |                                                                                                                                                    |                                                                                                                                        | |      |||                                        |                   |                                                                      | |*|     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1768D  ..    ..                                                                        |  |   | |                 |        |                                       |  |                      | |                                                           *                                                                                        |                                                                                                                                        | |      |||                                        |                   |                                                                      | |||     ||         |                                                                              
JMol viewer RasMol script viewer  CL 1774C  ..    ..                                                                        |  |   | |                 |        |                                       |  |                      | |                                                           |                                                                                        |                                                                                                                                        | |      |||                            *           |                   |                                                                      | |||     ||         |                                                                              
JMol viewer RasMol script viewer  NAG 1770C  ..    ..                                                                        |  |   | |                 |        |                                       |  |                      | |                                                           |                                                                                        |                                                                  *                                                                     | |      |||                            |           |                   |                                                                      | |||     ||         |                                           *                                  
JMol viewer RasMol script viewer  NAG 1767C  ..    ..                                                                        |  |   | |                 |        |                                       |  |                      | |                                                           |                                                                                        |                                                                * |                                                                     | |      |||                            |           |                   |                                                                      | |||     ||         |                                           |                                  
sec str:  ..............hhhhhhhhhhhhhhhh.....hhhhh...............hhhhhhhhhhhh....................eeeeeeee......eeeehhhhhhh..ee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh........eeee............eeeeeeee.....hhhh.eeeeeeeee....hhhhheeeeeee..eee.hhhhhhhhhhhh.............................eee......eeee..eeee..eeeeeeee...eeeeeeeee..eeeeeeeeeeeeeeee...hhhhhh.eee.hhh.............................................................eeeeeeeeeeeeeeeeee............................eee........eeeee..eeee.................eeeeeeeeeeeeeeee..eeeeeeeeeeeeeeee..hhh.eee..........................................hhhhhhhh.eeeeeee......................hhhhhh.......eeeeeeeeeeeee..hhhhh......................hhhhhh...eeee....................................
sequence :  ..PHCP..QLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSH
seq num:  ..39  ..58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718       728       738       748       758  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    ..|  |  |  |        | | | ||  || ||  |   ||                | |                   ^***                   | |   |  |                                    | |        | |  |     |   ^***|      | |     | | ||  |      |  |             ||||       ^***| || || |                    | |  |  |                 ||  |   |  |  |      |   || |||  |  ||||  |   |||||||| ||  |           | ||||     ||||               |    ||        | | |        | |                 | | | |   || | |    |           | |              |  |  |       | |    || || |  | | |     |^***|| |                | ^***  || || |||  | ||  |    | |           || |||^***| |      |    |   |  ||  | || |  |     | |    |  | ||   | |||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ..|  |  |  |        ^** | ||  || ||  |   ||                | |                                          | |   |  |                                    | |        | |  |     |    |  |      | |     | | ||  |      |  |             ||||        |  | |^**| |                    | |  |  |                 ||  |   |  |  |      |   || ^**  |  ||||  |   |||||||| ||  |           ^**|||     ||||               |    ||        | | |        | |                 | ^** |   || | |    |           | |              |  |  |       ^**    || || |  | ^**     | |^**| |                |  | |  || || |||  ^**|  |    | |           || ||| |||| |      |    |   |  ||  | || |  |     | |    |  | ||   | |||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ..|  |  ^***            | ||  || ||  |   ||                | |                                          | |   |  |                                    | |        | |  |     |    |  |      | |     | | ||  |      |  |             ||||        |  | || || |                    | |  |  |                 ||  |   |  ^***      |   ||  |   |  ||||  |   |||||||| |^***           ^***||     ||||               |    ||        | | |        | |                 | |   |   || | |    |           | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |      |    |   |  ||  | || |  |     | |    |  | ||   | |||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ..|  |                  | ||  || ||  |   ||                | |                                          | |   |  |                                    | |        | |  |     |    |  |      | |     | | ||  |      |  |             ||||        |  | || || |                    | |  |  |                 ********^            |   ||  |   |  ||||  |   |******^ |                  |||     ||||               |    ||        | | |        | |                 | |   |   || | |    |           | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |      |    |   |  ||  | || |  |     | |    |  | ||   | |||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ..|  |                  | ^***** ||  |   ||                | |                                          | |   |  |                                    | |        ^*****     ^*****  |      | |     | | ||  |      |  |             ||||        ^*****| || |                    ^*****  |                  |  |                ^*****  |   |  ||||  |   | |||||  |                  |||     ||||               ^*****|        | | |        | |                 | |   ^***** | ^*****           | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |      |    |   |  ||  | |^*****     | |    |  | ||   | |||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  RGD ..    ..|  |                  |  |  |  ||  |   ||                | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |      |  |             ||||           |  | || |                    | |  |  |                  |  |                    ||  |   |  ||||  |   | |||||  |                  |||     ||||                     |        | | |        | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |      |    |   |  ||  | || |        | |    |  | ||   ***||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_1 ..    ..|  |                  |  |  |  ||  |   ||                | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |      |  |             ||||           |  | || |                    | |  |  |                  |  |                    ||  |   |  ||||  |   | |||||  |                  |||     ||||                     ***********^**        | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |      |    |   |  ||  | || |        | |    |  | ||   |  ||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  COPPER_AMINE_OXID_2 ..    ..|  |                  |  |  |  ||  |   ||                | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |      |  |             ||||           |  | || |                    | |  |  |                  |  |                    ||  |   |  ||||  |   | |||||  |                  |||     ||||                              | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |      *****^********  | || |        | |    |  | ||   |  ||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    ..|  |                  |  |  |  ||  |   ||                | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |      |  |             ||||           |  | || |                    | |  |  |                  |  |                    ||  |   *****||  |   | |||||  |                  |||     ||||                              | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |               |  |   | || |        | |    |  | ||   |  ||  ||  | |||                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    ..|  |                  |  |  |  ||  |   ||                | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |      |  |             ||||           |  | || |                    | |  |  |                  |  |                    ||  |   |  | ||  |   | |||||  |                  |||     ||||                              | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |               |  |   | || |        | |    |  | ||   |  ||  ||  *****                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ..|  |                  |  |  |  ||  |   ||                | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |      |  |             ||||           |  | || |                    | |  |  |                  |  |                    ||  |   |  | ||  |   | |||||  |                  |||     ***|                              | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  | |  || || |||     |  |    | |           || ||| |||| |               |  |   | || |        | |    |  | ||   |  ||  ||  ***|                      
search RasMol script viewer Motif-ligand binding stats  betabulge ..    ..|  |                  |  |  |  ||  |   **                | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |      |  |             ||||           |  | || |                    | |  |  |                  |  |                    ||  |   |  | ||  |   | |||||  |                  |**      | |                              | |          | |                 | |       |  |                  | |              |  |  |              || || |  |         | |   | |                |  | |  || || |**     |  |    | |           || ||| |||| |               |  |   | || |        | |    |  | ||   |  ||  ||  |  |                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ..|  |                  |  |  |  ||  |                     | |                                          | |   |  |                                    | |          ****          |  |      | |     | | ||  |      ****             ||||           |  | || |                    | |  |  |                  ****                    ||  |   **** ||  |   ****|||  |                  | |      | |                              | |          | |                 | |       |  |                  | |              *******              ****| |  |         | |   | |                |  | ******** |       ****    | |           ****|| |||| |               |  |   | || |        | |    **** ||   |  ||  ||  ****                      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ..|  |                  |  |  |  ||  |                     | |                                          | |   |  |                                    | |          |  |          |  |      | |     | | ||  |                       ||||           |  | || |                    | |  |  |                                          ||  |   |    ||  |     | |||  |                  | |      | |                              | |          | |                 ***       |  |                  | |                 |  |               |  | |  |         | |   | |                |  | |     |  |               | |            |  |***||| |               |  |   | || |        | |    |  | ||   |  ||  ||  |                         
search RasMol script viewer Motif-ligand binding stats  nest ..    ..|  |                  |  |  |  ||  |                     ***                                          ***   |  |                                    ***          |  |          |  |      ***     | | ||  |                       ****           |  | || |                    | |  |  |                                          ||  |   |    ||  |     ***||  |                  ***      ***                              | |          ***                           |  |                  | |                 |  |               |  | |  |         | |   ***                |  | |     |  |               | |            |  |   ||| |               |  |   | |***        ***    |  | ||   |  ||  ||  |                         
search RasMol script viewer Motif-ligand binding stats  niche ..    ..****                  ****  ********                                                                        ****                                                 ****          ****              *********                                      *********                    ***  ****                                          |****   |    |****     ********                                                            ***          | |                           ****                  ***                 ****               **** ****         ***                      **** |     ****               | |            ****   *****               ****   ******        ***    *******   ************                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..    ..                                                                                                                                                                                                                                                   | |                                                                          *****   |    *****                                                                                      | |                                                                                                                                      | |                        | |                   | |                                                | |                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..    ..                                                                                                                                                                                                                                                   ***                                                                                  |                                                                                               ***                                                                                                                                      ***                        ***                   ***                                                ***                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..    ..                                                                                                                                                                                                                                                                                                                                        *                                                                                                                                                                                                                                                                                                                                                                                        

   New search    2c10:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors