triangle PDBeMotif: 2bv1  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Mon, Jun 20, 2005
Title regulator of g-protein signalling 1 (human)
Authors A.EDWARDS, A.HARONITI, C.ARROWSMITH, D.A.DOYLE, G.A.SCHOCH, J.M.ELKINS, M.SOUNDARARAJAN, M.SU, X.YANG
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATOR OF G-PROTEIN SIGNALLING 1
member of: CATH:search1.10.167.10/search1.10.196.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF34PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchQ08116
sec str:  ...eeeehhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..KDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQ
seq num:  ..58        68        78        88        98        108       118       128       138       148       158       168       178       188 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |  || |  ||   |  ^***|      |  ||||          ||  |  |            | |  |  |   | |   || |     | |  |       |  |      |  |   |   |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  || |  ||   |  |   |      |  ||||          ||  |  |            | |  |  |   | |   |^**     | |  |       |  |      |  |   |   |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***| |  ||   |  |   |      |  ||||          ||  ^***            | |  |  |   | |   |        | ^***       ^***      |  |   |   |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |   | |  ||   |  |   |      |  ||||          ||  |               | |  |  |   | |   |        | |                    |  |   |   |  |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |   | |  ||   |  *****      |  ||||          ||  |               | |  |  |   | |   |        | |                    |  |   |   |  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |   | |  ||   |  |          |  ||||          ||  |               | |  |  |   ***   |        | |                    |  |   |   |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |   | ****|   |  |          ****|||          ||  |               | |  |  |     |   |        | |                    ****   |   ****
search RasMol script viewer Motif-ligand binding stats  nest ..    |   |     |   |  |             ****          ||  |               | |  |  |     |   |        | |                    |  |   |       
search RasMol script viewer Motif-ligand binding stats  niche ..    |   |     |   ****                           |****               *********     |   |        | |                    ****   |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..    *****     *****                              |   |                             |   |        | |                       *****       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                             *****        | |                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                ***                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : REGULATOR OF G-PROTEIN SIGNALLING 1
member of: CATH:search1.10.167.10/search1.10.196.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF34PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchQ08116
sec str:  ...eeehhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLN
seq num:  ..59        69        79        89        99        109       119       129       139       149       159       169       179       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  ||         |  ^***|      || ||||          ||  |  |            | |  |             | |       |  |       |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  ||         |  |   |      || ||||          ||  |  |            | |  |             ^**       |  |       |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***|         |  |   |      || ||||          ||  ^***            | |  |                       ^***       ^***      |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |   |         |  |   |      || ||||          ||  |               | |  |                                            |  |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |   |         |  *****      || ||||          ||  |               | |  |                                            |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |         |  |          *****||          ||  |               | ****                                            ****        
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |         |  |             ****          ||  |               | |  |                                            |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |         ****                           |****               ******                                            ****        
search RasMol script viewer Motif-ligand binding stats  stmotif ..   *****                                        |   |                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                *****                                                                             

   New search    2bv1:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors