triangle PDBeMotif: 2bg9  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification ion channel/receptor    | release date: Fri, Dec 17, 2004
Title refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Authors N.UNWIN
Method ELECTRON MICROSCOPY (resolution: 4.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,D sequence:
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLINVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRL
PSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISP
ESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTVLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIVTVVVINTHHRSPSTHSAIEGVKYIAEHMK
SDEESSNAAEEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG
Chain B sequence:
SVMEDTLLSVLFENYNPKVRPSQTVGDKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSI
PSDDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWHPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVILQH
ALDAMINQDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIVPCILISILAILVFYLPPDAGEKM
SLSISALLALTVFLLLLADKVPETSLSVPIIISYLMFIMILVAFSVILSVVVLNLHHRSPNTHEAVEAIKYIAEQLESAS
EFDDLKKDWQYVAMVADRLFLYIFITMCSIGTFSIFLDASHNVPPDNPFA
Chain C sequence:
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISIL
RLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISM
DLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGE
KMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKE
KNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
Chain E sequence:
NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIP
SELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLS
AEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAG
GQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKST
KEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
member of: CATH:search1.20.58.390/search2.70.170.10GENE3D:searchG3DSA_1.20.120.370/searchG3DSA_2.70.170.10PANTHER:searchPTHR18945/searchPTHR18945_SF74PFAM:searchPF02931/searchPF02932PRINTS:searchNICOTINICR/searchNRIONCHANNELPROSITE PATTERNS:searchPS00236, SUPERFAMILY:searchSSF63712/searchSSF90112TIGRFAMS:searchTIGR00860UniProt:searchP02711
sec str:  ....hhhhhhhhhhhh..............eeeeeeeeeeeeeeee....eeeeeeeeeeee.................eeee........eee.......ee.....eeee.....eee..eeeeeee............eeeeeeeee.......eeee.................eeeeeeeeeee...........eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLINVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTVLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIVTVVVINTHHRSPSTHSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       378       388       398       408       418       428       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |||          |  || |                     |  | |            || ||                | |  | |     | |   | |        | |          | ||   |  |    ^***|      || || |   | |  | |||| |    ||            | |                          |  ||  |              |  ||   |         ||  ||| ||  || ||         |   |              |  ||  ||     |  | |  |  |                    |   |     |  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |||          |  || |                     |  | |            || ||                | |  | |     | |   | |        ^**          | ||   |  |     |^**      || || |   ^**  | |||| |    ||            | |                          |  ||  |              |  ||   |         ||  ||| ||  || ||         |   |              |  ||  ||     |  | |  |  |                    |   |     |  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|          |  || |                     |  | |            || ||                | |  | |     | |   | |                     ^***   |  |     |         || || |        | ^*** |    ||            | |                          |  ||  |              |  ||   |         ||  ||| ||  || ||         |   |              ^***|  ||     ^*** |  |  |                    |   |     |  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |||          |  || |                     |  | |            || ||                | |  | |     | |   | |                       |    |  |     |         |^*****        |  ||  |    ||            | |                          |  ||  |              |  ||   |         ||  ||| ||  || ||         |   |                  |  ||          |  |  |                    |   |     |  ||   
search RasMol script viewer Motif-ligand binding stats  NEUROTR_ION_CHANNEL ..| |||          |  || |                     |  | |            || ||                | |  | |     | |   | |                       ^*************^         || ||          |  ||  |    ||            | |                          |  ||  |              |  ||   |         ||  ||| ||  || ||         |   |                  |  ||          |  |  |                    |   |     |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |||          |  || |                     |  | |            || ||                | |  | |     | |   | |                            |  |               *****          |  ||  |    ||            | |                          |  ||  |              *****   |         ||  |*****  || ||         |   |                  *****          |  |  |                    |   |     *****   
search RasMol script viewer Motif-ligand binding stats  betabulge ..| |||          |  || |                     |  | |            || ||                | |  | |     | |   | |                            |  |               || ||          |  ||  |    **            | |                          |  ||  |              |  ||   |         ||  ||| ||  || ||         |   |                  |  |           |  |  |                    |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..| |||          |  || |                     ******            || ||                | |  | |     | |   | |                            |  |               || ||          |  ||  |                  | |                          |  ||  |              |  ||   |         ||  ||| ||  || ||         |   |                  |  |           |  |  |                    |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|          |  || |                        | |            ****|                | |  | |     | |   | |                            |  |               ****|          |  ||  |                  | |                          |  ||  |              ****|   |         ||  |****|  *****         |   |                  ****           *******                    |   |     ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |          |  |***                        | |             |  |                | |  ***     | |   | |                            |  |                |  |          |  ||  |                  | |                          |  ||  |                  |   |         ||  |||  |                |   |                                                            |   |             
search RasMol script viewer Motif-ligand binding stats  nest ..  ***          |  |                           ***             |  |                | |          ***   ***                            |  |                |  |          |  ||  |                  | |                          |  ||  |                  |   |         ||  |||  |                |   |                                                            |   |             
search RasMol script viewer Motif-ligand binding stats  niche ..               ****                                           ****                ***                ***                            ****                ****          ********                  ***                          |  ||  |                  |   |         ||  ||****                |   |                                                            |   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                             ********                  *****         ******                    *****                                                            *****             

chain B : ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN
member of: CATH:search1.20.58.390/search2.70.170.10GENE3D:searchG3DSA_1.20.120.370/searchG3DSA_2.70.170.10PANTHER:searchPTHR18945/searchPTHR18945_SF477PFAM:searchPF02931/searchPF02932PRINTS:searchNICOTINICR/searchNRIONCHANNELPROSITE PATTERNS:searchPS00236, SUPERFAMILY:searchSSF63712/searchSSF90112TIGRFAMS:searchTIGR00860UniProt:searchQ6S3I0
sec str:  ....hhhhhhhhhhhhh..............eeeee..eeeeeeee....eeeeeee.eeeee...............eeeee........eee.......ee.....eeeee...eeee..eeeeee................eeeeee........eee..................ee....eee...........eeee..ee.....hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......
sequence :  ..SVMEDTLLSVLFENYNPKVRPSQTVGDKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSIPSDDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWHPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVILQHALDAMINQDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIVPCILISILAILVFYLPPDAGEKMSLSISALLALTVFLLLLADKVPETSLSVPIIISYLMFIMILVAFSVILSVVVLNLHHRSPNTHEAVEAIKYIAEQLESASEFDDLKKDWQYVAMVADRLFLYIFITMCSIGTFSIFLDASHNVPPDNPFA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       180       190       200       210       220       230       240       250       260       270       280       290       300       310       410       420       430       440       450       460       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |||      |  ||  || | |  |  | | |    | ||    | |            |||||     |          | | ||||     | |   ||| |      | |            |||| |  |  | ^***       | |                 |  |        | |  |  | || |                     | | ||||  ||     || ||                   |   ||  |        |  ||                       |  ||    |   |  ||  ||     ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |||      |  ||  || | |  |  ^** |    | ||    | |            |||||     |          | | ||||     | |   ||| |      | |            |^** |  |  |  |         | |                 |  |        ^**  |  | || |                     | | ||||  ||     || ||                   |   ||  |        |  ||                       |  ||    |   |  ||  ||     ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|      |  ||  || | ^***      |    | ||    | |            |||||     |          | | ||||     | |   ||| |      | |            | |  |  |  |  |         | |                 |  |             |  | ^***                     | | ||||  ||     || ||                   |   ||  |        |  ||                       |  ||    |   ^***|  ||     ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |||      |  ||  || |           |    | ||    | |            ||********^          | | ||||     | |   ||| |      | |            | |  |  |  |  |         | |                 |  |             ******^                       | | ||||  ||     || ||                   |   ||  |        |  ||                       |  ||    |   |   |  ||     ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |||      |  ||  || |           ^***** ||    | |            || ||                | | ||||     | |   ||| |      | |            | |  |  |  |  |         | |                 |  |             |  | |                        | | ||||  ||     || ||                   |   ||  |        |  ||                       |  ||    |   |   |  ||     ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  NEUROTR_ION_CHANNEL ..| |||      |  ||  || |                  ||    | |            || ||                | | ||||     | |   ||| |      | |            ^*************^         | |                 |  |             |  | |                        | | ||||  ||     || ||                   |   ||  |        |  ||                       |  ||    |   |   |  ||     ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |||      |  ||  || |                  ||    | |            || ||                | | ||||     | |   ||| |      | |            | |  |  |  |            | |                 |  |             |  | |                        | **********     || ||                   |   ||  |        *****                       *****    |   |   *****     ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..| |||      |  ||  || |                  **    | |            || ||                | | ||||     | |   ||| |      | |            | |  |  |  |            | |                 |  |             |  | |                        | | || |  |      || ||                   |   ||  |        |  |                        |  |     |   |   |  |      ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|      |  ||  || |                        | |            ****|                | | ||||     | |   ||| |      | |            | ****  ****            | |                 |  |             |  | |                        | **** ****      *****                   |   |****        ****                        ****     |   |   ****      ||||      |   |                     | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |      |  ||  |***                        | |             |  |                | | ****     | |   ||| |      | |            ***  |  |               ***                 |  |             |  | |                        |   |                                    |   |                                                 |   |             ||||      |   |                     ***
search RasMol script viewer Motif-ligand binding stats  nest ..  ***      |  ||  |                           ***             |  |                ***          ***   *** |      ***                 |  |                                   |  |             |  | |                        |   |                                    |   |                                                 |   |             ****      |   |                        
search RasMol script viewer Motif-ligand binding stats  niche ..           ********                                           ****                                    ****                          ****                                   ****             ******                        |   |                                    |   |                                                 |   |                       |   |                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                          *****                                    *****                                                 *****                       *****                        

chain C : ACETYLCHOLINE RECEPTOR PROTEIN, DELTA CHAIN
member of: CATH:search1.20.58.390/search2.70.170.10GENE3D:searchG3DSA_1.20.120.370/searchG3DSA_2.70.170.10PANTHER:searchPTHR18945/searchPTHR18945_SF61PFAM:searchPF02931/searchPF02932PRINTS:searchNICOTINICR/searchNRIONCHANNELPROSITE PATTERNS:searchPS00236, SUPERFAMILY:searchSSF63712/searchSSF90112TIGRFAMS:searchTIGR00860UniProt:searchQ6S3H8
sec str:  ....hhhhhhhhhh...................eeeeeeeeeeeeeee....eeeeeeeeeeeee................eee.........eee...............eee....eeee..eeeeee..............eeeeeeee........eee.............eeeee..eeeee...........eeeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISMDLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       186       196       206       216       226       236       246       256       266       276       286       296       306       316       426       436       446       456       466       476      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | | |  |||||| ||  || | |                || || | |            || || ^***|| |      |  |                | |        | |            | |  |  | | |^***|                      |  |               |  |^***                  |   |    |  || |  ||                         | |    |  |               | |  ||    | | |    || ||||   |   |  |||  ||   |||| |    |   |        |  |||  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | | |  |||||| ||  || | |                |^**| | |            || ||  |  || |      |  |                | |        | |            | |  |  | | | |^**                      |  |               |  |                      |   |    |  || |  ||                         ^**    |  |               | |  ||    | | |    || ||||   |   |  |||  ||   |||| |    |   |        |  |||  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | | |  |||||| ||  || | |                |^*** | |            || ||  |  || |      |  |                | |        | |            | |  |  | | | |                         |  |               |  |                      |   |    |  || |  ||                                |  |               | |  ||    | | |    ^***|||   |   |  |||  ||   |||| |    |   |        |  |||  |     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| | | |  |||||| ||  || | |                ||    | |            || ||  |  || |      |  |                | |        | |            | |  |  | | | |                         |  |               |  |                      |   |    |  || |  ||                                |  |               | |  ||    | | |    ||  |||   ********^|  ||   |||| |    |   |        |  |||  |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| | | |  |||||| ||  || | |                ||    | |            || ||  |  || |      |  |                | |        | |            | |  |  | | | |                         |  |               |  |                      |   |    |  || |  ||                                |  |               ^*****^***** | |    |^*****       |  |||  ||   |||| |    |   |        |  |||  |     
search RasMol script viewer Motif-ligand binding stats  NEUROTR_ION_CHANNEL ..| | | |  |||||| ||  || | |                ||    | |            || ||  |  || |      |  |                | |        | |            ^*************^                         |  |               |  |                      |   |    |  || |  ||                                |  |                 |  ||      | |    ||  ||        |  |||  ||   |||| |    |   |        |  |||  |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| | | *****|||| ||  || | |                ||    | |            || ||  |  || |      |  |                | |        | |            | |  |  | | |                           |  |               |  |                      |   |    ***** *****                                |  |                 *****      | |    ||  ||        **********   |||| |    |   |        *****|  |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..| | | |  |||||| ||  || | |                **    | |            || ||  |  || |      |  |                | |        | |            | |  |  | | |                           |  |               |  |                      |   |    |  |  |  |                                 |  |                 |  |       | |    ||  ||        |  | |  |    |||| |    |   |        |  | |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..| | | ****|**** ||  || | |                      | |            ****|  |  || |      ****                | |        | |            | |  |  | | |                           |  |               |  |                      |   |    ****  ****                                 ****                 ****       | |    ||  ||        **** ****    ||****    |   |        **** ****     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |     | ||  ||  |*** |                      | |             |  |  |  || |      |  |                | |        ***            ***  |  | | |                           |  |               |  |                      |   |                                               |  |                            | |    ||  ||                     ||||      |   |                      
search RasMol script viewer Motif-ligand binding stats  nest ..  ***     ***|  ||  |  ***                      ***             |  |  |  || |      |  |                ***                            |  | ***                           |  |               |  |                      |   |                                               |  |                            | |    ||  ||                     ****      |   |                      
search RasMol script viewer Motif-ligand binding stats  niche ..             ********  ***                                      ****  |  ****      ****                                               **** ***                           ****               ****                      |   |                                               ****                            ***    ||  ||                               |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                      *****                                                                                                                                           *****                                                                                      ******                               *****                      

chain D : ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
member of: CATH:search1.20.58.390/search2.70.170.10GENE3D:searchG3DSA_1.20.120.370/searchG3DSA_2.70.170.10PANTHER:searchPTHR18945/searchPTHR18945_SF74PFAM:searchPF02931/searchPF02932PRINTS:searchNICOTINICR/searchNRIONCHANNELPROSITE PATTERNS:searchPS00236, SUPERFAMILY:searchSSF63712/searchSSF90112TIGRFAMS:searchTIGR00860UniProt:searchP02711
sec str:  ....hhhhhhhhhhhh...............eee....eeeeeeee....eeeeeee..eee.................eeee........eee..............eeee.....eee..eeeeeee.............eeeeeeee........eee.................eeeeeeeeeee...........eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLINVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTVLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIVTVVVINTHHRSPSTHSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       378       388       398       408       418       428       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |||          |  || |                     |  |||            ||| | | |           |  |          | |   | |        | |          | ||           ^***|      || || |   | |    | || |    ||            | |                            |  ||                  |  ||     |  |       |  |  |  |  |             |   |  |     |  |          || | |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |||          |  || |                     |  |||            ||| | | |           |  |          | |   | |        ^**          | ||            |^**      || || |   ^**    | || |    ||            | |                            |  ||                  |  ||     |  |       |  |  |  |  |             |   |  |     |  |          || | |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|          |  || |                     |  |||            ||| | | |           |  |          | |   | |                     ^***            |         || || |          ^*** |    ||            | |                            |  ||                  |  ||     |  |       |  |  |  |  |             |   |  |     ^***          ^*** |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |||          |  || |                     |  |||            ||| | | |           |  |          | |   | |                       |             |         |^*****            |  |    ||            | |                            |  ||                  |  ||     |  |       |  |  |  |  |             |   |  |                    |   |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  NEUROTR_ION_CHANNEL ..| |||          |  || |                     |  |||            ||| | | |           |  |          | |   | |                       ^*************^         || ||              |  |    ||            | |                            |  ||                  |  ||     |  |       |  |  |  |  |             |   |  |                    |   |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |||          |  || |                     |  |||            ||| | | |           |  |          | |   | |                                               *****              |  |    ||            | |                            *****                  *****     |  |       |  |  |  |  |             |   |  |                    |   |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| |||          |  || |                     *****|            ||| | | |           |  |          | |   | |                                               || ||              |  |    ||            | |                            |  |                   |  |      |  |       |  |  |  |  |             |   |  |                    |   |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..| |||          |  || |                     |  | |            *** | ***           |  |          | |   | |                                               || ||              |  |    ||            | |                            |  |                   |  |      |  |       |  |  |  |  |             |   |  |                    |   |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..| |||          |  || |                     |  | |             |  |               |  |          | |   | |                                               || ||              |  |    **            | |                            |  |                   |  |      |  |       |  |  |  |  |             |   |  |                    |   |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..| |||          |  || |                     ******             |  |               |  |          | |   | |                                               || ||              |  |                  | |                            |  |                   |  |      |  |       |  |  |  |  |             |   |  |                    |   |  |     ||||              |   |     |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|          |  || |                        | |             ****               ****          | |   | |                                               ****|              |  |                  | |                            ****                   ****      ****       |  |  *******             |   ****                    |   ****     ||||              |   |     ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |          |  |***                        | |             |  |               |  |          | |   | |                                                |  |              |  |                  | |                                                                        |  |                      |   |                       |   |        ||||              |   |             
search RasMol script viewer Motif-ligand binding stats  nest ..  ***          |  |                           ***             |  |               |  |          ***   ***                                                |  |              |  |                  | |                                                                        |  |                      |   |                       |   |        ****              |   |             
search RasMol script viewer Motif-ligand binding stats  niche ..               ****                                           ****               ****                ***                                                ****              ****                  ***                                                                        ****                      |   |                       |   |                          |   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                                                                     *****                       *****                          *****             

chain E : ACETYLCHOLINE RECEPTOR PROTEIN, GAMMA CHAIN
member of: CATH:search1.20.58.390/search2.70.170.10GENE3D:searchG3DSA_1.20.120.370/searchG3DSA_2.70.170.10PANTHER:searchPTHR18945/searchPTHR18945_SF59PFAM:searchPF02931/searchPF02932PRINTS:searchNICOTINICR/searchNRIONCHANNELPROSITE PATTERNS:searchPS00236, SUPERFAMILY:searchSSF63712/searchSSF90112UniProt:searchQ6S3H9
sec str:  ...hhhhhhhhhhhhh...............eeeeeeeeeeeeee....eeeeeeeeeeeee............................eee................ee....eeee..eeeeee.................eeeee.........ee.................eeeee....ee.............eeee..eeee....hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       178       188       198       208       218       228       238       248       258       268       278       288       298       308       417       427       437       447       457       467       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | | |  | |  | | || |         | |       |  | | |            | |   ^*** |       |  |       |  |      | |        | |            |       | |  ^***        |  |    |  |       |  |  | |            | ||              | |                       |  ||    |            |  ||                        |   |      ^***||    |  |       | || ^*** ||         || ||       |   |    |  || |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | | |  | |  | | || |         ^**       |  | | |            | |     |  |       |  |       |  |      | |        | |            |       | |   |          |  |    |  |       |  |  ^**            | ||              | |                       |  ||    |            |  ||                        |   |        ^**|    |  |       ^**|   || ||         || ||       |   |    |  || |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | | |  | |  | | || |                   ^*** | |            | |     ^***       |  |       |  |      | |        | |            |       | |   |          |  |    ^***       |  |                 ^***              | |                       |  ||    |            |  ||                        |   |         | |    ^***       ^***   ^***|         || ||       |   |    |  || |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | | |  | |  | | || |                        | |            | |                |  |       |  |      | |        | |            |       | |   |          |  |               |  |                 | |               | |                       |  |^*****            |  ||                        |   |         | |                       |  |         || ||       |   |    |  || |   
search RasMol script viewer Motif-ligand binding stats  NEUROTR_ION_CHANNEL .. | | |  | |  | | || |                        | |            | |                |  |       |  |      | |        | |            ^*************^          |  |               |  |                 | |               | |                       |  |                  |  ||                        |   |         | |                       |  |         || ||       |   |    |  || |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | | |  | |  | | || |                        | |            | |                |  |       |  |      | |        | |                    | |              |  |               |  |                 | |               | |                       |  |                  *****                        |   |         | |                       |  |         *****       |   |    ***** |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. | | |  | |  | | || |                        | |            ***                |  |       |  |      | |        | |                    | |              |  |               |  |                 | |               | |                       |  |                  |  |                         |   |         | |                       |  |         || ||       |   |    |  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn .. | | **** |  | | || |                        | |                               ****       ****      | |        | |                    | |              |  |               |  |                 | |               | |                       |  |                  ****                         |   |         | |                       ****         *****       |   |    *******   
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |      |  | | |***                        | |                                                    | |        | |                    | |              |  |               |  |                 | |               ***                       |  |                                               |   |         | |                                                |   |              
search RasMol script viewer Motif-ligand binding stats  nest .. ***      |  | | |                           ***                                                    ***        ***                    | |              |  |               |  |                 ***                                         |  |                                               |   |         | |                                                |   |              
search RasMol script viewer Motif-ligand binding stats  niche ..          **** ***                                                                                                                    ***              ****               ****                                                             ****                                               |   |         ***                                                |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                                                              *****                                                            *****              

   New search    2bg9:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML