triangle PDBeMotif: 2bbm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification calcium-binding protein    | release date: Thu, Jul 16, 1992
Title solution structure of a calmodulin-target peptide complex by multidimensional nmr
Authors A.BAX, A.M.GRONENBORN, G.M.CLORE, M.IKURA
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD
SEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Chain B sequence:
KRRWKKNFIAVSAANRFKKISSSGAL
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CALMODULIN
member of: CATH:search1.10.238.10GENE3D:searchG3DSA_1.10.238.10PANTHER:searchPTHR23050/searchPTHR23050_SF150PFAM:searchPF13499PROSITE PATTERNS:searchPS00018, PROSITE PROFILES:searchPS50222, SMART:searchSM00054SUPERFAMILY:searchSSF47473UniProt:searchP62152
JMol viewer RasMol script viewer  CA 184A  ..                                                                                                                                *   * *    *        
JMol viewer RasMol script viewer  CA 183A  ..                                                                                            * * * *    *                        |   | |    |        
JMol viewer RasMol script viewer  CA 182A  ..                                                       * * *      *                         | | | |    |                        |   | |    |        
JMol viewer RasMol script viewer  CA 181A  ..                   * * *      *                        | | |      |                         | | | |    |                        |   | |    |        
sec str:  .......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh...hhhhhhhhhh.........hhhhhhhhhhh.......hhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhh..
sequence :  ..ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  ||||  || ||||| | ||||| | ||| ||| | |   || |||||||  | | ^***|  ||  || |    | || |        | | | | |  || ||  || |  |  ||  |||  | | | | | |||||  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||||  || ||||| | ||||| ^**|| ||| | |   || |||||||  | | | | |  ||  || |    | || |        | | | | |  || ||  || |  |  ||  |||  | | | | | |||||  ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  ||||  || |||^*** ||||| ^***| ||| | |   ^***||||||  | | | | |  ||  || |    ^*** |        | | | | ^***| ||  || |  ^***|  |||  | | | | | |||||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  ||||  || ||||| | |||^*****|| ||| | ^***** |||||||  | | | | |  ||  || |      |  |        | | | | |  || ||  || |      |  |||  | | | | | |||||  |  
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 .. |  ||||  || ||||| ^*^*^*^*^**^* ||| |        |||||||  ^*^*^*^*^**^*  || |      |  |        ^*^*^*^*^**^* ||  || |      |  |||  ^*^*^*^*^**^*||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  ||||  |*****|| | |||||   | ***** |        |******  |   | |     ***** |      |  |            | |    ********* |      *****|  |   | |   *****  |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****||*********** | |||||   | *******        *******  |   | |     ****  |      ****            | |    ********| |      **** ****   | |   ****|  |  
search RasMol script viewer Motif-ligand binding stats  nest ..    ****   |    |  | *****   |   |                  |  |   ***        |  |                      ***            ***           |  |   ***       |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..           |    ****         |   |                  ****              ****                                                   ****             ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..           |                 *****                                                                                                                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..           *                                                                                                                                        

chain B : MYOSIN LIGHT CHAIN KINASE
member of: PANTHER:searchPTHR24347/searchPTHR24347_SF118UniProt:searchP07313
sec str:  ....hhhhhhhhhhhhhhhhhh......
sequence :  ..KRRWKKNFIAVSAANRFKKISSSGAL
seq num:  ..1         11        21    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        |  ||||||**^*||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ***********||||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **********|||||   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  |****   
search RasMol script viewer Motif-ligand binding stats  niche ..                  ***     

   New search    2bbm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML