triangle PDBeMotif: 2axi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.3.2.
Classification ligase/ligase inhibitor    | release date: Mon, Sep 5, 2005
Title hdm2 in complex with a beta-hairpin
Authors J.ROBINSON, M.G.GRUETTER, P.R.E.MITTL, R.FASAN
Method X-RAY DIFFRACTION (resolution: 1.40Å)
PDBe Citation   
Small molecules:    search MPO MPO binding statistics MPO   search SO4 SO4 binding statistics SO4
Modified residues:  search 6CW 6CW binding statistics 6CW
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEH
RKIYTMIYRNLVVVNQQESSDSGTSVSENHHHHHH
Chain B sequence:
PFEWLDWEFX
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-PROTEIN LIGASE E3 MDM2
member of: CATH:search1.10.245.10GENE3D:searchG3DSA_1.10.245.10PANTHER:searchPTHR10360/searchPTHR10360_SF11PFAM:searchPF02201PIRSF:searchPIRSF006748/searchPIRSF500700SUPERFAMILY:searchSSF47592UniProt:searchQ00987
JMol viewer RasMol script viewer  MPO 201A  ..                            **  *                                                           
JMol viewer RasMol script viewer  SO4 302A  ..      *                     ||  |                                                       *   
JMol viewer RasMol script viewer  SO4 301A  ..      |                     *|  |                                                       |   
sec str:  ......eeeehhhhhhhhhhh......eehhhhhhhhhhhhhhhh.ee..eeeeee...hhhhhhhh..eee..hhhhhhhhhhh.eee.....
sequence :  ..EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
seq num:  ..23        33        43        53        63        73        83        93        103         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||              | | |   ^**|          ^**||   |  |  |  ||| ||| |   ^**|||   | || ||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***|              | | |   ^***           ||||   |  |  |  ||| ||| |   ^***||   | || ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |              | | |                  ||||   |  |  |  ||| ||| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |              | | |                  ||||   |  |  |  |*****| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |              | | |                  ||||   |  |  |  *** | | |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |              | | |                  ||||   ****  |  |**** | |   ****||   | ****|       
search RasMol script viewer Motif-ligand binding stats  nest .. | |              *** |                  ****   |  |  |  |     ***   | | ||   |  |  |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***                ***                   ***   ****  ****           | | ||   |  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                     *****|   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                     | |  *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                     ***                    

chain B : CYCLIC 8-MER PEPTIDE
JMol viewer RasMol script viewer  MPO 201A  ..      *   
sec str:  ...eee..eee.
sequence :  ..PFEWLDWEFP
seq num:  ..20        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-PROTEIN LIGASE E3 MDM2
member of: CATH:search1.10.245.10GENE3D:searchG3DSA_1.10.245.10PANTHER:searchPTHR10360/searchPTHR10360_SF11PFAM:searchPF02201PIRSF:searchPIRSF006748/searchPIRSF500700SUPERFAMILY:searchSSF47592UniProt:searchQ00987
JMol viewer RasMol script viewer  MPO 201A  ..                            **  *                                                           
JMol viewer RasMol script viewer  SO4 302A  ..      *                     ||  |                                                      **   
JMol viewer RasMol script viewer  SO4 301A  ..      |                     *|  |                                                      ||   
sec str:  ......eeeehhhhhhhhhhh......eehhhhhhhhhhhhhhhh.ee..eeeeee...hhhhhhhh..eee..hhhhhhhhhhh.eee.....
sequence :  ..EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
seq num:  ..23        33        43        53        63        73        83        93        103         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||              | | |   ^**|          ^**||   |  |  |  ||| ||| |   ^**|||   | || ||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***|              | | |   ^***           ||||   |  |  |  ||| ||| |   ^***||   | || ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |              | | |                  ||||   |  |  |  ||| ||| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |              | | |                  ||||   |  |  |  |*****| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |              | | |                  ||||   |  |  |  *** | | |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |              | | |                  ||||   ****  |  |**** | |   ****||   | ****|       
search RasMol script viewer Motif-ligand binding stats  nest .. | |              *** |                  ****   |  |  |  |     ***   | | ||   |  |  |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***                ***                   ***   ****  ****           | | ||   |  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                     *****|   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                     | |  *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                     ***                    

chain B : CYCLIC 8-MER PEPTIDE
JMol viewer RasMol script viewer  MPO 201A  ..      *   
sec str:  ...eee..eee.
sequence :  ..PFEWLDWEFP
seq num:  ..20        

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-PROTEIN LIGASE E3 MDM2
member of: CATH:search1.10.245.10GENE3D:searchG3DSA_1.10.245.10PANTHER:searchPTHR10360/searchPTHR10360_SF11PFAM:searchPF02201PIRSF:searchPIRSF006748/searchPIRSF500700SUPERFAMILY:searchSSF47592UniProt:searchQ00987
JMol viewer RasMol script viewer  MPO 201A  ..                   ****     **  **                                                          
JMol viewer RasMol script viewer  SO4 302A  ..      *            ||||     ||  ||                                                      *   
JMol viewer RasMol script viewer  SO4 301A  ..      |            ||||     *|  ||                                                      |   
sec str:  ......eeeehhhhhhhhhhh......eehhhhhhhhhhhhhhhh.ee..eeeeee...hhhhhhhh..eee..hhhhhhhhhhh.eee.....
sequence :  ..EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
seq num:  ..23        33        43        53        63        73        83        93        103         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||              | | |   ^**|          ^**||   |  |  |  ||| ||| |   ^**|||   | || ||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***|              | | |   ^***           ||||   |  |  |  ||| ||| |   ^***||   | || ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |              | | |                  ||||   |  |  |  ||| ||| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |              | | |                  ||||   |  |  |  |*****| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |              | | |                  ||||   |  |  |  *** | | |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |              | | |                  ||||   ****  |  |**** | |   ****||   | ****|       
search RasMol script viewer Motif-ligand binding stats  nest .. | |              *** |                  ****   |  |  |  |     ***   | | ||   |  |  |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***                ***                   ***   ****  ****           | | ||   |  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                     *****|   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                     | |  *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                     ***                    

chain B : CYCLIC 8-MER PEPTIDE
JMol viewer RasMol script viewer  MPO 201A  ..      *   
sec str:  ...eee..eee.
sequence :  ..PFEWLDWEFP
seq num:  ..20        

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-PROTEIN LIGASE E3 MDM2
member of: CATH:search1.10.245.10GENE3D:searchG3DSA_1.10.245.10PANTHER:searchPTHR10360/searchPTHR10360_SF11PFAM:searchPF02201PIRSF:searchPIRSF006748/searchPIRSF500700SUPERFAMILY:searchSSF47592UniProt:searchQ00987
JMol viewer RasMol script viewer  MPO 201A  ..                            **  *                                                           
JMol viewer RasMol script viewer  SO4 302A  ..      *                     ||  |                                                      **   
JMol viewer RasMol script viewer  SO4 301A  ..      |                     *|  |                                                      ||   
sec str:  ......eeeehhhhhhhhhhh......eehhhhhhhhhhhhhhhh.ee..eeeeee...hhhhhhhh..eee..hhhhhhhhhhh.eee.....
sequence :  ..EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
seq num:  ..23        33        43        53        63        73        83        93        103         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||              | | |   ^**|          ^**||   |  |  |  ||| ||| |   ^**|||   | || ||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***|              | | |   ^***           ||||   |  |  |  ||| ||| |   ^***||   | || ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |              | | |                  ||||   |  |  |  ||| ||| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |              | | |                  ||||   |  |  |  |*****| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |              | | |                  ||||   |  |  |  *** | | |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |              | | |                  ||||   ****  |  |**** | |   ****||   | ****|       
search RasMol script viewer Motif-ligand binding stats  nest .. | |              *** |                  ****   |  |  |  |     ***   | | ||   |  |  |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***                ***                   ***   ****  ****           | | ||   |  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                     *****|   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                     | |  *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                     ***                    

chain B : CYCLIC 8-MER PEPTIDE
sec str:  ...eee..eee.
sequence :  ..PFEWLDWEFP
seq num:  ..20        

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-PROTEIN LIGASE E3 MDM2
member of: CATH:search1.10.245.10GENE3D:searchG3DSA_1.10.245.10PANTHER:searchPTHR10360/searchPTHR10360_SF11PFAM:searchPF02201PIRSF:searchPIRSF006748/searchPIRSF500700SUPERFAMILY:searchSSF47592UniProt:searchQ00987
JMol viewer RasMol script viewer  MPO 201A  ..                            **  *                                                           
JMol viewer RasMol script viewer  SO4 302A  ..      *                     ||  |                                                       *   
JMol viewer RasMol script viewer  SO4 301A  ..      |                     *|  |                                                       |   
sec str:  ......eeeehhhhhhhhhhh......eehhhhhhhhhhhhhhhh.ee..eeeeee...hhhhhhhh..eee..hhhhhhhhhhh.eee.....
sequence :  ..EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
seq num:  ..23        33        43        53        63        73        83        93        103         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||              | | |   ^**|          ^**||   |  |  |  ||| ||| |   ^**|||   | || ||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***|              | | |   ^***           ||||   |  |  |  ||| ||| |   ^***||   | || ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |              | | |                  ||||   |  |  |  ||| ||| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |              | | |                  ||||   |  |  |  |*****| |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |              | | |                  ||||   |  |  |  *** | | |   | ||||   | || ||       
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |              | | |                  ||||   ****  |  |**** | |   ****||   | ****|       
search RasMol script viewer Motif-ligand binding stats  nest .. | |              *** |                  ****   |  |  |  |     ***   | | ||   |  |  |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***                ***                   ***   ****  ****           | | ||   |  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                     *****|   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                     | |  *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                     ***                    

chain B : CYCLIC 8-MER PEPTIDE
JMol viewer RasMol script viewer  MPO 201A  ..      *   
sec str:  ...eee..eee.
sequence :  ..PFEWLDWEFP
seq num:  ..20        

   New search    2axi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors