triangle PDBeMotif: 2awp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Thu, Sep 1, 2005
Title crystal structure of plasmodium knowlesi structure of iron super-oxide dismutase
Authors A.BOCHKAREV, A.DONG, A.M.EDWARDS, C.H.ARROWSMITH, CONSORTIUM (SGC), G.WASNEY, I.KOEIERADZKI, J.LEW, J.WEIGELT, M.AMANI, M.MELONE, M.SUNDSTROM, M.VEDADI, R.HUI, STRUCTURAL GENOMICS, Y.ZHAO, Z.ALAM
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search UNX UNX binding statistics UNX   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQIWNHSFYWDS
MGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTHDAGNPIKDNTGIPILTCDIW
EHAYYIDYRNDRPSYVKAWWNLVNWNFANENLKKALQK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : IRON SUPER-OXIDE DISMUTASE
member of: GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchD0VWV6
JMol viewer RasMol script viewer  UNX 1000A  ..                                                                                                                                                                                                     
JMol viewer RasMol script viewer  CL 2002A  ..                     *  *                                                                                                                                                                            
sec str:  .....................hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeee...hhhhhh.eeeeeeee.hhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhh
sequence :  ..MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQIWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRPSYVKAWWNLVNWNFANENLKKALQ
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | || |  |                     | || | |  ||  |||  | |    |     ^*** |  |                   |||   ||   |  |  | |    |   | | |       | |    ||||      | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | || |  |                     | || | |  |^***||  | |    |          |  |                   |||   ||   |  |  | |    |   | | |       | |    ||||      | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | || |  |                     | || | |  ||   ||  | ^*****          |  |                   |^*****|   |  |  | ^*****   | | |       | |    ||||      | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..          | || |  |                     | || | |  ||   ||  |                 |  |                   | |   ||   |  |  |          | | |       | |    ||||      ^***^***             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | || |  |                     | || | |  ||   ||  |                 |  |                   | |   ||   |  |  |          | | |       | |    ||||      | |                  *****| | |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          | || |  |                     | || | |  ||   ||  |                 |  |                   | |   ||   |  |  |          | | |       | |    ||||      | |                  || ||*****         
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | || |  |                     | || | |  ||   ||  |                 |  |                   | |   ||   |  |  |          *** |       | |    ||||      | |                  || ||***           
search RasMol script viewer Motif-ligand binding stats  betaturn ..          **** |  |                     | || | |  ||   ||  |                 |  |                   | |   ||   |  |  |            | |       | |    ||||      | |                  ****|              
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |                     | || | |  ||   ||  |                 |  |                   ***   ||   |  |  |            ***       | |    ****      | |                   |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..            *******                     ****** ****|   |****                 ****                     |   ||   |  ****                      ***              ***                   ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                             | |   *****   |                                          *****|   |                                                                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                             | |       *****                                               *****                                                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                             ***                                                                                                                                                     

chain B : IRON SUPER-OXIDE DISMUTASE
member of: GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchD0VWV6
JMol viewer RasMol script viewer  UNX 3001B  ..                                                                                                                                                                                                   
JMol viewer RasMol script viewer  UNX 1001B  ..                                                                                                                                                                                                   
JMol viewer RasMol script viewer  CL 2001B  ..                                                                                   *    *                                                                                              **          
sec str:  ....................hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.....eeeeeee...hhhhhh..eeeeeee.hhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhh
sequence :  ..AIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTGAIFNNAAQIWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLNNNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRPSYVKAWWNLVNWNFANENLKKAL
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | ||  |                     | || | |  ||  |||  | |    |     ^*** | ||                    ||   |       |  | |    |     | |      || ||   ||||      | | |  |             || ||| |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | ||  |                     | || | |  |^***||  | |    |        | | ||                    ||   |       |  | |    |     | |      || ||   ||||      | | |  |             || ||| |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | ||  |                     | || | |  ||   ||  | ^*****        | | ||                    ^*****       |  | ^*****     | |      || ||   ||||      | | |  |             || ||| |          
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..           | ||  |                     | || | |  ||   ||  |               | | ||                     |   |       |  |            | |      || ||   ||||      ^***^***             || ||| |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | *****                     | || | |  ||   ||  |               | | ||                     |   |       |  |            | |      || ||   ||||      | |                  *****| |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |  |  |                     | || | |  ||   ||  |               | | ||                     |   |       |  |            | |      || |*****|||      | |                  || ||| |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |  |                     | || | |  ||   ||  |               | | ||                     |   |       |  |            | |      || |    ||||      | |                  || ||***          
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |  |                     | || | |  ||   ||  |               | | ||                     |   |       |  |            | |      ****    ||||      | |                  ****|             
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |  |                     | || | |  ||   ||  |               | | ||                     |   |       |  |            ***       | |    ****      | |                   |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..           *******                     ****** ****|   |****               | ****                     |   |       ****                      ***              ***                   ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                            | |   *****   |               |   |                      *****                                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            | |       *****               *****                                                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                            ***                                                                                                                                                    

   New search    2awp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors