triangle PDBeMotif: 2af0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Mon, Jul 25, 2005
Title structure of the regulator of g-protein signaling domain of rgs2
Authors A.EDWARDS, C.ARROWSMITH, C.JOHANNSON, C.PHILLIPS, C.SMEE, D.A.DOYLE, E.PAPAGRIGORIOU, F.VON DELFT, J.M.ELKINS, J.WEIGELT, M.SUNDSTROM, STRUCTURAL GENOMICS CONSORTIUM (SGC)
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ADLGTENLYFQSMKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYT
DFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATOR OF G-PROTEIN SIGNALING 2
member of: CATH:search1.10.167.10/search1.10.196.10GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF43PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchP41220
sec str:  .....hhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..ADLGTENLYFQSMKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQ
seq num:  ..58        68        78        88        98        108       118       128       138       148       158       168       178       188       198   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |      || | |  |          |  |           | |||           ||  | |    | | |   ||  |  |  |    |   | |  ||   | |    |     | ||^*** ||  |  | |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |      |^** |  |          |  |           | |||           ||  | |    ^** |   ||  |  |  |    |   | |  ||   | |    |     | ||  |  ||  |  | |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |      |  | ^***          |  |           | |||           ||  | |        |   ||  |  |  |    |   | |  ||   | |    |     ^***  |  ||  |  | |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |      |  |               |  |           | |||           ||  | |        |   ||  |  |  |    |   | |  ||   | |    |       |   |  *******^ |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |      |  |               |  |           | |||           ||  | |        |   ||  |  |  |    |   | |  ||   | ^*****       |   |   |  |    |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |      |  |               |  |           | |||           ||  | |        |   ||  |  |  |    |   | *****   | |            |   |   |  |    |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |      |  |               |  |           ****|           ||  | |        |   ||  ****  |    |   | ****    | |            |   |   |  |    |  |   
search RasMol script viewer Motif-ligand binding stats  nest .. | |      |  |               |  |             ***           ||  | |        |   ||  |  |  |    |   |         | |            |   |   |  |    |  |   
search RasMol script viewer Motif-ligand binding stats  niche .. ***      ****               ****                           |******        |   |**********    |   |         | |            |   |   ****    ****   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                            *****          *****              *****         | |            *****                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                            ***                                   

   New search    2af0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors