triangle PDBeMotif: 2aeb  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.5.3.1
Classification hydrolase/hydrolase inhibitor    | release date: Thu, Jul 21, 2005
Title crystal structure of human arginase i at 1.29 a resolution a exploration of inhibition in immune response.
Authors A.C.OCHOA, A.MORA, D.W.CHRISTIANSON, F.CENTE, G.SABIO, L.DI COSTANZO, P.C.RODRIGUEZ
Method X-RAY DIFFRACTION (resolution: 1.29Å)
PDBe Citation   
Small molecules:    search ABH ABH binding statistics ABH   search MN MN binding statistics MN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARGINASE 1
member of: CATH:search3.40.800.10GENE3D:searchG3DSA_3.40.800.10PANTHER:searchPTHR11358/searchPTHR11358_SF17PFAM:searchPF00491PIRSF:searchPIRSF036979PRINTS:searchARGINASEPROSITE PATTERNS:searchPS01053, PROSITE PROFILES:searchPS51409, SUPERFAMILY:searchSSF52768TIGRFAMS:searchTIGR01229UniProt:searchP05089
JMol viewer RasMol script viewer  ABH 551A  ..                                                                                                *                      * * * *      *   **                                        *                                                * *                                          *                                         
JMol viewer RasMol script viewer  MN 2363A  ..                                                                                                |                      * | * |      |   ||                                        |                                                | |                                          |                                         
JMol viewer RasMol script viewer  MN 2362A  ..                                                                                                |                      | | | |      |   ||                                        |                                                | *                                          |                                         
sec str:  ....eeeeeee.......hhhhhhhhhhhhhhhhhhhhhhh..eeeeeee................hhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhh................hhh.eeeeee...hhhhhhhhhhhh.eeeehhhhhhhhhhhhhhhhhhhhhh.....eeeeee.hhh................hhhhhhhhhhhhhhhh.eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh..............
sequence :  ..SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |    ||| | |   |  || ||||||||||      | |      | |    | | |  ||   |  ||  |  |  | |     | | |||||||||||| |  |     | ||||| |  | |||   |  |  ||  || |  | ||| |    ^**|| |  |       | || || |   | || ||    | |  || | |  |      | |||||   |          | ^**|| ||||||| ||||| ||| ||||| | | ||  || |||||     | ||  |  | || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |    ||| | |   |  || ||||||||||      | |      | |    | | |  ||   |  ||  |  |  | |     | | |||||||||||| |  |     | ||||| |  | |||   |  |  ||  || |  | ||| |    ^***| |  |       | || || |   ^*** ||    | |  || | |  |      | |||||   |          | ^***| ||||||| ||||^***| ||||| | ^***  || |||||     | ||  |  | || |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       |    ||| | |   |  || ||||||||||      | |      | |    | | |  ||   |  ||  |  |  | |     | | |||||||||||| |  |     | ||||| |  | |||   |  |  ||  || |  | ||| |    || || |  |       | || || |   | || ||    ********^ |  |      | |||||   |          |    || ||||||| ||||  | | ||||| | | ||  || |||||     | ||  |  | || |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ^*****^*****   |  || ||||||||||      | |      | |    | | |  ||   |  ||  |  |  | |     ^*****||^*****|| |  |     | ||||| |  | |^*****  |  ||  || |  | ||| |    || || |  |       | || || |   | || ||      |  ||   |  |      | |||^*****          |    |^*****||| |^***** | ||||| | | ||  || |||||     | ||  |  | || |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..              | |     |  || ||||||||||      | |      | |    | | |  ||   |  ||  |  |  | |       | | || |||| || |  |     | ||||| |  | | |      |  ||  || |  | ||| |    || || |  |       | || || |   | || ||      |  ||   ^***      | ||| |              |    || ||||||| ||||    | ||||| | | ||  || |||||     | ||  |  | || |
search RasMol script viewer Motif-ligand binding stats  ARGINASE_1 ..              | |     |  || ||||||||||      | |      | |    | | |  ||   |  ||  |  |  | |       | | || |||| || |  |     | ||||| |  | | |      |  ||  || |  | ||| |    || || |  |       | || || |   | || ||      |  ||             **^*^*****************    || ||||||| ||||    | ||||| | | ||  || |||||     | ||  |  | || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |     ***** ||*******|      | |      | |    | | *****   |  ||  |  |  | |       | | *****|| || |  |     | ||||| |  | | |      |  ||  || |  | ||| |    || || |  |       | ***** |   | *****      *****                |  |                   |********* ||||    | ||||| | | |***********     | ||  |  | || |
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | |     |  || |||||||| |      ***      | |    | | |  |    |  ||  |  |  | |       *** || | || || |  |     ***|||| |  | | |      |  ||  || |  | ||| |    || || |  |       | || || |   | || ||      |  |                 |  |                   || ||||||  ||||    | ||*** | | ||  || || |      | ||  |  | |***
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |     ****************               | |    | | ****    ********  **** |           **** ***** |  |        |||| |  | | |      |  ||  || |  ****| |    ****| |  |       ******| |   | *****      ****                 |  |                   *********  ||||    | || |  | | |**********      | |****  | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | |            ||||                    | |    | |                      | |            |   |     |  |        |||| |  | | |      |  ||  || |    ||| |     |  | |  |             | |   | |                               |  |                              ||||    | || |  | | |                | |      ***   
search RasMol script viewer Motif-ligand binding stats  nest ..              | |            ****                    | |    | |                      ***            |   |     |  |        **** |  | ***      |  ||  |***    *** |     |  | |  |             ***   | |                               |  |                              ****    | || |  | | |                ***            
search RasMol script viewer Motif-ligand binding stats  niche ..              ***                                    ***    ***                                     |   |     ****         *** ****          ***********     ****     **** ****                   | |                               ****                              |***    **** **** | |                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                    *****                  |                                                                      | |                                                                 | |       |       | |                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                           |                                                                      ***                                                                 ***       |       ***                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                           *                                                                                                                                                    *                                         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ARGINASE 1
member of: CATH:search3.40.800.10GENE3D:searchG3DSA_3.40.800.10PANTHER:searchPTHR11358/searchPTHR11358_SF17PFAM:searchPF00491PIRSF:searchPIRSF036979PRINTS:searchARGINASEPROSITE PATTERNS:searchPS01053, PROSITE PROFILES:searchPS51409, SUPERFAMILY:searchSSF52768TIGRFAMS:searchTIGR01229UniProt:searchP05089
JMol viewer RasMol script viewer  ABH 552B  ..                                                                                                *                      * * * *      *   *                                         *                                                * *                                          *                                    
JMol viewer RasMol script viewer  MN 1363B  ..                                                                                                |                      * | * |      |   |                                         |                                                | |                                          |                                    
JMol viewer RasMol script viewer  MN 1362B  ..                                                                                                |                      | | | |      |   |                                         |                                                | *                                          |                                    
sec str:  .....eeeee........hhhhhhhhhhhhhhhhhhhhhhh...eeeeee................hhhhhhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhhhhh.............hhh.eeee.....hhhhhhhhhhhh.eeehhhhhhhhhhhhhhhhhhhhhhh.....eeeeee.hhh................hhhhhhhhhhhhhhhh.eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh.........
sequence :  ..SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHK
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||||| | |      ||||||||||| || |   | |      | |    | | |  |||||||||    ||||||||     | | |||||||||||| |  |     | ||||| |  | |||   |  |  |  || ||  | ||| |    ^**|| |  |         |  || |   | || || |  ||| ||| |||  |      | |||||   |          | ^**|| ||||||  ||||| ||| || |  | |  |         || |||| ||  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       || ||||| | |      ||||||||||| || |   | |      | |    | | |  |||||||||    ||||||||     | | |||||||||||| |  |     | ||||| |  | |||   |  |  |  || ||  | ||| |    ^***| |  |         |  || |   ^*** || |  ||| ||| |||  |      | |||||   |          | ^***| ||||||  ||||^***| || |  | ^***         || |||| ||  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       || ||||| | |      ||||||||||| || |   | |      | |    | | |  |||||||||    ||||||||     | | |||||||||||| |  |     | ||||| |  | |||   |  |  |  || ||  | ||| |    ||||| |  |         |  || |   | || || |  ********^||  |      | |||||   |          |    || ||||||  ||||  | | || |  |              || |||| ||  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ^*****^*****      ||||||||||| || |   | |      | |    | | |  |||||||||    ||||||||     ^*****||^*****|| |  |     | ||||| |  | |^*****  |  |  || ||  | ||| |    ||||| |  |         |  || |   | || || |  ||| ||| |||  |      | |||^*****          |    |^*****||  |^***** | || |  |              || |||| ||  |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..        | ||  | |        ||||||||||| || |   | |      | |    | | |  |||||||||    ||||||||       | | || |||| || |  |     | ||||| |  | | |      |  |  || ||  | ||| |    ||||| |  |         |  || |   | || || |  ||| ||| ||^***      | ||| |              |    || ||| ||  ||||    | || |  |              || |||| ||  |   
search RasMol script viewer Motif-ligand binding stats  ARGINASE_1 ..        | ||  | |        ||||||||||| || |   | |      | |    | | |  |||||||||    ||||||||       | | || |||| || |  |     | ||||| |  | | |      |  |  || ||  | ||| |    ||||| |  |         |  || |   | || || |  ||| ||| |||  |      **^*^*****************    || ||| ||  ||||    | || |  |              || |||| ||  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | ||  | |        |||||****** || |   | |      | |    | | ************    *******|       | | *****|| || |  |     | ||||| |  | | |      |  |  || ||  | ||| |    ||||| |  |         ***** |   | ***** *************|  |        ||| |                   || |*****  ||||    | || |  |              |*****| ||  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | ||  | |        ||||||||||  || |   ***      | |    | | |  |||||| |     ||||||||       *** || | || || |  |     ***|||| |  | | |      |  |  || ||  | ||| |    ||||| |  |         |  || |   | || || |  ||| ||| |||  |        *** |                   || ||| |   ||||    | || |  |              || || | ||  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |**** |        *************| |            | |    | | ***********     *******|           **** ***** |  |        |||| |  | | |      |  |  ****|  ****| |    ****| |  |         ****| |   | ***** *************|  |         |  |                   ********   ||||    | || |  |              ***** | |****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***   | |         |  ||||     | |            | |    | |                      | |            |   |     |  |        |||| |  | | |      |  |   |  |    ||| |    ||| | |  |             | |   | |                  |  |         |  |                    |   |     ||||    | || |  |                    | |       
search RasMol script viewer Motif-ligand binding stats  nest ..              | |         |  ****     | |            | |    | |                      ***            |   |     |  |        **** |  | ***      |  |   |  |    *** |    ||| | |  |             ***   | |                  |  |         |  |                    |   |     ****    | || |  |                    ***       
search RasMol script viewer Motif-ligand binding stats  niche ..              ***         |    |      ***            ***    ***                                     |   |     ****         *** ****          ****   ****     ****    |**** ****                   | |                  ****         ****                    |   |      ***    **** ****                              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                          ******                                                                    |   |                  |                                         | | |                        | |                                                       |   |               |                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    |   |                  |                                         *****                        | |                                                       |   |               |                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                    *****                  |                                         | |                          | |                                                       *****               |                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                           |                                         ***                          ***                                                                           |                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                           *                                                                                                                                                    *                                    

   New search    2aeb:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML