triangle PDBeMotif: 2abj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.6.1.42
Classification transferase    | release date: Fri, Jul 15, 2005
Title crystal structure of human branched chain amino acid transam complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5 phosphate.
Authors A.MIST, C.H.HASEMANN, D.W.MORELAND, H.L.HU, J.D.SCHOLTEN, J.F.OHREN, J.R.RUBIN, P.C.MCCONNELL, W.T.MUELLER
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search PLP PLP binding statistics PLP   search CBC CBC binding statistics CBC
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,D,G,J sequence:
VVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKA
FRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPAFIGTEPSLGVKKPTK
ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRDHQITEVGT
MNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFSSGTACVVCPV
SDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE, CYTOS
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF29PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchP54687
JMol viewer RasMol script viewer  CBC 2401D  ..                                                                     *                                                                                    *                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  PLP 420A  ..                                                                     |                            *                                                       |                                    *         *    *                             *  ***                       * ***                                         **                                                     
JMol viewer RasMol script viewer  CBC 1401A  ..                            *                                        |    *                       |                                         *             |                 *                  |         *    *               **            |  **|                       | |||                                         *|**  *                                                
sec str:  .......hhhhhee..........hhhhh........eeeeeeee...ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee...........eeeeeeeeeee...........eeee..................hhhhhhhhhhhhhhhhh...eeeeee....eeeee..eeeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh..eeeeeeee...eeeeeeeeee..eeee..hhhhhhhhhhhhhhhhhhhhh.......eee..
sequence :  ..VVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPAFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFSSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |||||                   | |  |                      ^***|  |  | | |          | |||                   | |   | |          | || || || ||         | | ||| | ||            | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| | |||        ||||  | |  || | ||  |||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || |||||                   | |  |                          |  |  | | |          | |||                   | |   | |          | || || || ||         | | ||| **^*            | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| | |||        ||||  | |  || | ||  |||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**||||                   | |  |                          |  |  | | |          | |||                   | |   | |          | || || || ||         | | |||                 | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| | ^**        ||||  ^**  || | ||  |||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |||||                   | |  |                          |  |  | | |          | |||                   | |   | |          | || || || ||         | | |||                 | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| |  |         ||||       ^*** |^***||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |||||                   | |  |                          |  |  | | |          | |||                   | |   | |          ********^| ||         | | |||                 | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| |  |         ||||        |   |    ||||||                               |   |  | ******^||| |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****||                   ^*****                          |  |  | | |          | |||                   | |   | |            || ||  | ||         ^*****|                 | |            |  |      ^***** ^*****       || |||         | |  ||  |       | | |        ||||| |  |         ||||        |   |    ||||||                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..     || ||                   | |                             |  |  | | |          | |||                   | |   | |            || ||  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ***********************************         ||||        |   |    ||||||                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..     || ||                   | |                             |  |  | | |          | |||                   | |   ***            || ||  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ||  |       *** |        ||||| |            ||||        |   |    ||||||                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..     || ||                   | |                             |  |  | | |          | |||                   | |                  || ||  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ||  |         | |        ||||| |            ||||        |   |    ||||**                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     || ||                   | |                             |  |  | | |          *****                   | |                  || ||  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ||  |         | |        ||||| |            ||||        |   |    ||||                                 |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|                   | |                             |  **** | |          ****|                   | |                  *****  | ||         | | | |                 | |            |  |       |  ||              |****|         | |  |****         | |        ||||| |            ||||        |   |    ||||                                 |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |                   | |                             |  |    | |            | |                   | |                   |  |  | ||         | | | |                 | |            |  |       |  ||              |  | |         | |  |             | |        ||||***            ||||        |   |    ||||                                 |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |                   ***                             |  |    ***            ***                   ***                   |  |  | ||         | | | |                 | |            |  |       |  ||              |  ***         ***  |             ***        ****|              ****        |   |    ****                                 |   |  |   |   **** |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..      ****                   ***                             ****                                                               ****  ****         *******                 ***            ****       ****|              |    |              |                         ***|                          |   |     ***                                 |   |  |   |        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                      | |                                                                |              ******              |                            |                          |   |                                         |   |  |   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                      | |                                                                |                                  |                            |                          *****                                         *****  *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                      ***                                                                |                                  |                            |                                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                         *                                  *                            *                                                                                                    

chain D : BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE, CYTOS
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF29PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchP54687
JMol viewer RasMol script viewer  PLP 420D  ..                                                                                                  *                                                                         ..PLP ..             *         *    *                             *  ***                       * ***                                         **                                                    
JMol viewer RasMol script viewer  CBC 2401D  ..                            *                                             *                       |                                         *                               ..CBC ..             |         *    *               **            |  **|                       | |||                                         *|**                                                  
JMol viewer RasMol script viewer  CBC 1401A  ..                            |                                             |                       |                                         |                               ..CBC ..             |         |    |               ||            |  |||                       | |||                                         ||||                                                  
sec str:  .......hhhhhee..........hhhhh........eeeeeeee...ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee...........eeeeeeeeeee..... .....eeeee.................hhhhhhhhhhhhhhhhh...eeeeee....eeeee..eeeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh..eeeeeeee...eeeeeeeeee..eeee..hhhhhhhhhhhhhhhhhhhhh.......eee.
sequence :  ..VVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPAFIGTEPSLGVKKPTKALLFVLLSPVGP... ..FNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFSSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVL
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179         ... ..197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || ||| |    | |     ||| |  |    |                      ^***|  |    | |          | |||                   | |   |   |        |  |  | || ||         | | ||| | ||             ..PS00001..        |  |   |  ||  || |    |       || |||         | |  |             | |        ||||| | |||        ||||  | |  || | ||  |||||||                                        |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || ||| |    | |     ||| |  |    |                          |  |    | |          | |||                   | |   |   |        |  |  | || ||         | | ||| **^*             ..PS00004..        |  |   |  ||  || |    |       || |||         | |  |             | |        ||||| | |||        ||||  | |  || | ||  |||||||                                        |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|| |    | |     ||| |  |    |                          |  |    | |          | |||                   | |   |   |        |  |  | || ||         | | |||                  ..PS00005..        |  |   |  ||  || |    |       || |||         | |  |             | |        ||||| | ^**        ||||  ^**  || | ||  |||||||                                        |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   || |    | |     ||| |  |    |                          |  |    | |          | |||                   | |   |   |        |  |  | || ||         | | |||                  ..PS00006..        |  |   |  ||  || |    |       || |||         | |  |             | |        ||||| |  |         ||||       ^*** |^***||||||                                        |     |||| |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   || |    | |     ||| |  |    |                          |  |    | |          | |||                   | |   |   |        ********^| ||         | | |||                  ..PS00007..        |  |   |  ||  || |    |       || |||         | |  |             | |        ||||| |  |         ||||        |   |    ||||||                                        ******^||| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** |    | |     ||| |  ^*****                          |  |    | |          | |||                   | |   |   |           |  |  | ||         ^*****|                  ..PS00008..        |  |   |  ^***** ^*****       || |||         | |  |             | |        ||||| |  |         ||||        |   |    ||||||                                              |||| |  |   
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..      |  |    | |     ||| |                                  |  |    | |          | |||                   | |   |   |           |  |  | ||         | | | |                  ..PS00770..        |  |   |  ||  ||              || |||         | |  ***********************************         ||||        |   |    ||||||                                              |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |    | |     ||| |                                  |  |    | |          | |||                   | |   *****           |  |  | ||         | | | |                  ..asxmotif..        |  |   |  ||  ||              || |||         | |  |             | |        ||||| |            ||||        |   |    ||||||                                              |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |    | |     *** |                                  |  |    | |          | |||                   | |                   |  |  | ||         | | | |                  ..asxturn..        |  |   |  ||  ||              || |||         | |  |             | |        ||||| |            ||||        |   |    ||||||                                              |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..      |  |    | |      |  |                                  |  |    | |          | |||                   | |                   |  |  | ||         | | | |                  ..betabulge..        |  |   |  ||  ||              || |||         | |  |             | |        ||||| |            ||||        |   |    ||||**                                              |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |    | |      |  |                                  ****    | |          ****|                   | |                   ****  | ||         | | | |                  ..betaturn..        |  |   ****|  ||              |****|         | |  |             | |        ||||| |            ||||        |   |    ||||                                                |||| |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |    | |      |  |                                  |  |    | |            | |                   | |                   |  |  | ||         | | | |                  ..gammaturn..        |  |       |  ||              |  | |         | |  |             | |        ||||***            ||||        |   |    ||||                                                |||| |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |    | |      |  |                                  |  |    ***            ***                   ***                   |  |  | ||         | | | |                  ..nest..        |  |       |  ||              |  ***         ***  |             ***        ****|              ****        |   |    ****                                                **** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..      ****    ***      ****                                  ****                                                               ****  ****         *******                  ..niche..        ****       ****|              |    |              |                            |                          |   |     ***                                                     ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                      | |                                   ..schellmannloop..                       |              ******              |                            |                          |   |                                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                      | |                                   ..ststaple..                       |                                  |                            |                          *****                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                      ***                                   ..stturn..                       |                                  |                            |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                            ..REP00000..                       *                                  *                            *                                                                                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain G : BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE, CYTOS
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF29PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchP54687
JMol viewer RasMol script viewer  CBC 4401J  ..                                                                                                                                                        *                 ..CBC ..                                                                                                                                                                                            
JMol viewer RasMol script viewer  PLP 420G  ..                                                                                                *                                                       |                 ..PLP ..             *         *    *                             *  ***                       * ***                                         **                                                     
JMol viewer RasMol script viewer  CBC 3401G  ..                          *                                             *                       |                                         *             |                 ..CBC ..             |         *    |               **            |  **|                       | |||                                         *|**  *                                                
sec str:  .....hhhhhee..........hhhhh........eeeeeeee...ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee...........eeeeeeeeeee..... .....eeeee.................hhhhhhhhhhhhhhhhh...eeeeee....eeeee..eeeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh..eeeeeeee...eeeeeeeeee..eeee..hhhhhhhhhhhhhhhhhhhhh.......eee..
sequence :  ..GTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPAFIGTEPSLGVKKPTKALLFVLLSPVGP... ..FNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFSSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS
seq num:  ..21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       ... ..197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| ||| |    | |            | |  |                      ^***|  |    | |          | |||                   | |   |   |        |  |  | || ||         | | ||| | ||             ..PS00001..        |  |   |  ||  || | || ||      || |||         | |  |             | |        ||||| | |||        ||||  | |  |  |  |  |||||                                        | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| ||| |    | |            | |  |                          |  |    | |          | |||                   | |   |   |        |  |  | || ||         | | ||| **^*             ..PS00004..        |  |   |  ||  || | || ||      || |||         | |  |             | |        ||||| | |||        ||||  | |  |  |  |  |||||                                        | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|^**|| |    | |            | |  |                          |  |    | |          | |||                   | |   |   |        |  |  | || ||         | | |||                  ..PS00005..        |  |   |  ||  || | || ||      || |||         | |  |             | |        ||||| | ^**        ||||  ^**  |  |  |  |||||                                        | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   || |    | |            | |  |                          |  |    | |          | |||                   | |   |   |        |  |  | || ||         | | |||                  ..PS00006..        |  |   |  ||  || | || ||      || |||         | |  |             | |        ||||| |  |         ||||       ^***  ^***||||                                        | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|   || |    | |            | |  |                          |  |    | |          | |||                   | |   |   |        ********^| ||         | | |||                  ..PS00007..        |  |   |  ||  || | || ||      || |||         | |  |             | |        ||||| |  |         ||||                 ||||                                        | ******^||| |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^***** |    | |            ^*****                          |  |    | |          | |||                   | |   |   |           |  |  | ||         ^*****|                  ..PS00008..        |  |   |  ^***** ^*****|      || |||         | |  |             | |        ||||| |  |         ||||                 ||||                                        |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..    |  |    | |            | |                             |  |    | |          | |||                   | |   |   |           |  |  | ||         | | | |                  ..PS00770..        |  |   |  ||  ||   ||  |      || |||         | |  ***********************************         ||||                 ||||                                        |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |  |    | |            | |                             |  |    | |          | |||                   | |   *****           |  |  | ||         | | | |                  ..asxmotif..        |  |   |  ||  ||   ||  |      || |||         | |  |             | |        ||||| |            ||||                 ||||                                        |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |    | |            | |                             ****    | |          ****|                   | |                   |  |  | ||         | | | |                  ..betaturn..        |  |   ****|  ||   |****      |****|         | |  |             | |        ||||| |            ||||                 ||||                                        |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |  |    | |            | |                             |  |    | |            | |                   | |                   |  |  | ||         | | | |                  ..gammaturn..        |  |       |  ||   |   |      |  | |         | |  |             | |        ||||***            ||||                 ||||                                        |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |    | |            | |                             |  |    ***            ***                   ***                   |  |  | ||         | | | |                  ..nest..        |  |       |  ||   |   |      |  ***         ***  |             ***        ****|              ****                 ****                                        |   |   **** |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..    ****    ***            ***                             ****                                                               ****  ****         *******                  ..niche..        ****       ****|   |   |      |    |              |                            |                                    ***                                        |   |        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                    | |                                   ..schellmannloop..                       |   |   |      ******              |                            |                                                                               |   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                    | |                                   ..ststaple..                       |   *****                          |                            |                                                                               *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                    ***                                   ..stturn..                       |                                  |                            |                                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                          ..REP00000..                       *                                  *                            *                                                                                                    

chain J : BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE, CYTOS
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF29PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchP54687
JMol viewer RasMol script viewer  PLP 420J  ..                                                                                                  *                                                                                            *         *    *                             *  ***                       * ***                                         **                                                     
JMol viewer RasMol script viewer  CBC 4401J  ..                            *                                             *                       |                                         *                               *                  |         *    *               **            |  **|                       | |||                                         *|**  *                                                
JMol viewer RasMol script viewer  CBC 3401G  ..                            |                                        *    |                       |                                         |             *                 |                  |         |    |               ||            |  |||                       | |||                                         ||||  |                                                
sec str:  .......hhhhhee..........hhhhh........eeeeeeee...ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee...........eeeeeeeeeee...........eeeee.................hhhhhhhhhhhhhhhhh...eeeeee....eeeee..eeeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh..eeeeeeee...eeeeeeeeee..eeee..hhhhhhhhhhhhhhhhhhhhh.......eee..
sequence :  ..VVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPAFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFSSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |||||            |  | | |||  |                      ^***|  |  | | |          | |||                   | |   |   |        |  |  | || ||         | | ||| | ||            | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| | |||        ||||  | |  || ||||  |||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || |||||            |  | | |||  |                          |  |  | | |          | |||                   | |   |   |        |  |  | || ||         | | ||| **^*            | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| | |||        ||||  | |  || ||||  |||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**||||            |  | | |||  |                          |  |  | | |          | |||                   | |   |   |        |  |  | || ||         | | |||                 | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| | ^**        ||||  ^**  || ||||  |||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |||||            |  | | |||  |                          |  |  | | |          | |||                   | |   |   |        |  |  | || ||         | | |||                 | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| |  |         ||||       ^***||^***||||||                               |   |  | | |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |||||            |  | | |||  |                          |  |  | | |          | |||                   | |   |   |        ********^| ||         | | |||                 | |            |  |      ||  || |    |       || |||         | |  ||  |       | | |        ||||| |  |         ||||       ||  ||    ||||||                               |   |  | ******^||| |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****||            |  | | ^*****                          |  |  | | |          | |||                   | |   |   |           |  |  | ||         ^*****|                 | |            |  |      ^***** ^*****       || |||         | |  ||  |       | | |        ||||| |  |         ||||       ||  ||    ||||||                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..     || ||            |  | | |||                             |  |  | | |          | |||                   | |   |   |           |  |  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ***********************************         ||||       ||  ||    ||||||                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     || ||            |  | | |||                             |  |  | | |          | |||                   | |   *****           |  |  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ||  |       | | |        ||||| |            ||||       ||  ||    ||||||                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..     || ||            |  | | |||                             |  |  | | |          | |||                   | |                   |  |  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ||  |       *** |        ||||| |            ||||       ||  ||    ||||||                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..     || ||            |  | | |||                             |  |  | | |          | |||                   | |                   |  |  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ||  |         | |        ||||| |            ||||       ||  ||    ||||**                               |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     || ||            |  | | |||                             |  |  | | |          *****                   | |                   |  |  | ||         | | | |                 | |            |  |       |  ||              || |||         | |  ||  |         | |        ||||| |            ||||       ||  ||    ||||                                 |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|            **** ****|                             |  **** | |          ****|                   | |                   ****  | ||         | | | |                 | |            |  |       |  ||              |****|         | |  |****         | |        ||||| |            ||||       ||  ||    ||||                                 |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |                   | |                             |  |    | |            | |                   | |                   |  |  | ||         | | | |                 | |            |  |       |  ||              |  | |         | |  |             | |        ||||***            ||||       ||  ||    ||||                                 |   |  |   |   |||| |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |                   ***                             |  |    ***            ***                   ***                   |  |  | ||         | | | |                 | |            |  |       |  ||              |  ***         ***  |             ***        ****|              ****       ||  ||    ****                                 |   |  |   |   **** |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..      ****                                                   ****                                                               ****  ****         *******                 ***            ****       ****|              |    |              |                            |                         ||  ||     ***                                 |   |  |   |        ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                      | |                                                                |              ******              |                            |                         ||  ||                                         |   |  |   |                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                      | |                                                                |                                  |                            |                         *****|                                         |   |  |   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                      | |                                                                |                                  |                            |                          *****                                         *****  *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                      ***                                                                |                                  |                            |                                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                         *                                  *                            *                                                                                                    

   New search    2abj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors