triangle PDBeMotif: 2a72  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Mon, Jul 4, 2005
Title structure of the regulator of g-protein signaling domain of
Authors A.EDWARDS, C.ARROWSMITH, C.JOHANSSON, C.PHILLIPS, C.SMEE, D., F.VON DELFT, G.A.SCHOCH, J.DEBRECZENI, J.M.EL, M.SUNDSTROM, O.GILEADI, STRUCTURAL GENOMICS CONSORTIUM (SGC)
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SMKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAI
NLDSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATOR OF G-PROTEIN SIGNALLING 7
member of: GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF26PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchP49802
JMol viewer RasMol script viewer  CL 301A  ..                                                                                                                       *  *          
sec str:  .......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SMKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQA
seq num:  ..318       328       338       348       358       368       378       388       398       408       418       428       438          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| || |   ||  | |   || | |           ||||           |  | |  |         |  | ||   |     ||  ||      | ||  |                |  |   |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**| |   ||  | |   || | |           ||||           |  | |  |         |  | ||   |     ||  ||      | ||  |                |  |   |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^*** |   ||  | |   || | |           ||||           |  | |  |         |  | ||   |     ||  ||      | |^***                |  |   |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |   ||  | ^***** | |           ||||           |  | |  |         |  | ^*****     ||  ||      | |                    |  |   |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |   ||  |     |  ***           ||||           |  | |  |         |  |  |         ||  ||      | |                    |  |   |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |   |****     |  |             ||||           **** ****         |  |  |         ||  ||      | |                    |  |   |     
search RasMol script viewer Motif-ligand binding stats  nest ..     |   |         |  |             ****           |  |              |  |  |         ||  ||      ***                    |  |   |     
search RasMol script viewer Motif-ligand binding stats  niche ..     |   |         ****                            ****              *******         ||  ||                             ****   |     
search RasMol script viewer Motif-ligand binding stats  stmotif ..     *****                                                                           ||  ||                                *****     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                     ******                                          

chain B : REGULATOR OF G-PROTEIN SIGNALLING 7
member of: GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF26PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchP49802
JMol viewer RasMol script viewer  CL 301A  ..                                                                                                                                     
sec str:  .......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SMKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQA
seq num:  ..318       328       338       348       358       368       378       388       398       408       418       428       438          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| ||       |  ||   || | |         | ||||           |  | |  |         |  | ||   |     |   |       | ||  |       |  |     |  |   |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**|       |  ||   || | |         | ||||           |  | |  |         |  | ||   |     |   |       | ||  |       |  |     |  |   |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***       |  ||   || | |         | ||||           |  | |  |         |  | ||   |     |   |       | |^***       |  |     |  |   |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |^***** | |         | ||||           |  | |  |         |  | ^*****     |   |       | |           |  |     |  |   |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |    |  ***         | ||||           |  | |  |         |  |  |         |   |       | |           |  |     |  |   |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****    |  |           ****||           |  | ****         |  |  |         |   |       | |           ****     ****   |     
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |             ****           |  |              |  |  |         |   |       ***                    |  |   |     
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****                            ****              *******         |   |                              ****   |     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                     |   |                                 *****     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                     *****                                           

   New search    2a72:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors