triangle PDBeMotif: 2a1x  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.14.11.18
Classification oxidoreductase    | release date: Tue, Jun 21, 2005
Title human phytanoyl-coa 2-hydroxylase in complex with iron and 2 oxoglutarate
Authors A.EDWARDS, C.ARROWSMITH, C.J.SCHOFIELD, D.BUTLER, F.V, G.BUNKOCZI, K.L.KAVANAGH, M.A.MCDONOUGH, M.SUNDSTROM, STRUCTURAL GENOMICS CONSORTIUM (SGC), T.SEARLES, U.OPPERMAN
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search FE2 FE2 binding statistics FE2   search AKG AKG binding statistics AKG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSE
YAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIV
CAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNK
TQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHYTANOYL-COA DIOXYGENASE
member of: GENE3D:searchG3DSA_2.60.120.620PANTHER:searchPTHR21308/searchPTHR21308_SF1PFAM:searchPF05721SUPERFAMILY:searchSSF51197UniProt:searchO14832
JMol viewer RasMol script viewer  AKG 451A  ..        ..                                                        ..      *                                    * *     ..  * *               *                             ..AKG ..     ..                          *        *                           ..                    
JMol viewer RasMol script viewer  FE2 450A  ..        ..                                                        ..      |                                    | |     ..  * *               |                             ..FE2 ..     ..                        * |        |                           ..                    
sec str:  ...............hhhhhhhhhheeee....hhhhhhhhhhhhhhhhh........eee..eee.....eee..eee....hhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeee........hhhhhh.eehhh.eeeeeee..........eee..hhhhh.......... ...............eee......eeee.....eee........eeeeeeeeee...ee.....hhhhhhhh..hhhhhhhhhheeee......
sequence :  ..QFQYTLDN..LTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISK..SEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPD..PLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDY... ..HGIQD..EENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEK..NLKDIWMFRARLVKGERTNL
seq num:  ..43      ..53        63        73        83        93        103   ..114       124       134       144       154        ..173       183       193       203       213       ... ..234  ..240       250       260       270       280       290          ..319       329       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |   ..           | |    | |              | ||||  | |        | ..| |      ||| |   | | || |         | |   ||         ..     |  |    |  |    |  |  | || |   | |||| | |    ..PS00001..     ..           |  |    |  |  |   ^***|          | |||  ||| | ||    ..|   | |  |  ||      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |   ..           | |    | |              | ||||  | |        | ..| |      ||| |   | | || |         | |   ||         ..     |  |    |  |    |  |  | || |   | |||| | |    ..PS00004..     ..           |  |    |  |  |   ||| |          | |||  ||| | ||    ..|   | |  |  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |   ..           | |    | |              | ||||  | |        | ..^**      ||| |   | | || |         | |   ||         ..     |  |    |  |    |  |  | || |   | |^** ^**    ..PS00005..     ..           |  |    |  |  |   ||| |          | |||  ||| | ||    ..|   | |  |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |   ..           | |    | |              | ||||  | |        ^*..         ||| |   | | ^***         | |   ||         ..     |  |    |  |    ^***  | || |   | |||  |      ..PS00006..     ..           |  |    |  |  |   ||| |          | |||  ||| ^***    ..|   | |  |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |   ..           | |    | |              | ||||  | |          ..         ||| |   | |  |           | |   ||         ..     |  |    |  |          | || |   | ^*****      ..PS00008..     ..           |  |    |  |  ^*****| |          | |||  ||| | |     ..|   | |  |  ||      
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. |  |   ..           | |    | |              | ||||  | |          ..         ||| |   | |  |           | |   ||         ..     |  |    |  |          | || |   | |||         ..PS00009..     ..           |  |    |  |      | | |          | |||  ||| | |     ..|   | |  |  ||      
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |   ..           | |    | |              | ||||  | |          ..         ||| ***** |  |           | |   ||         ..     |  |    |  |          | || |   | |||         ..asxmotif..     ..           |  |    |  |      | | |          | |||  ||| | |     ..***** |  |  ||      
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |   ..           | |    | |              | ||||  | |          ..         ||| |     |  |           | |   ||         ..     |  |    |  |          | || |   | |||         ..asxturn..     ..           |  |    |  |      *** |          | |||  ||| | |     ..      |  |  ||      
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |   ..           | |    | |              | ||||  | |          ..         ||| |     |  |           | |   **         ..     |  |    |  |          | || |   | |||         ..betabulge..     ..           |  |    |  |      | | |          | |||  ||| | |     ..      |  |  **      
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |   ..           | |    | |              ****||  | |          ..         |****     |  |           | |              ..     ****    |  |          | || |   ****|         ..betaturn..     ..           |  |    ****      | | |          ****|  ||| | |     ..      |  |          
search RasMol script viewer Motif-ligand binding stats  nest .. |  |   ..           ***    ***                ****  | |          ..         *** |     |  |           | |              ..     |  |    |  |          | |***     ***         ..nest..     ..           |  |    |  |      | | |          | |||  ||| | |     ..      |  |          
search RasMol script viewer Motif-ligand binding stats  niche .. ****   ..                  ***                      ***          ..          ****     ****           ***              ..     ****    ****          | |                    ..niche..     ..           ****    ****      *****          ****|  ***** |     ..      ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..        ..                                                        ..                                                   ..                           | |                    ..stmotif..     ..                               | |          *****      | |     ..                    
search RasMol script viewer Motif-ligand binding stats  stturn ..        ..                                                        ..                                                   ..                           ***                    ..stturn..     ..                               ***          ***        ***     ..                    

   New search    2a1x:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors