triangle PDBeMotif: 2a1a  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.
Classification protein synthesis/transferase    | release date: Sun, Jun 19, 2005
Title pkr kinase domain-eif2alpha complex
Authors A.C.DAR, F.SICHERI, T.E.DEVER
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Modified residues:  search TPO TPO binding statistics TPO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKG
YIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPP
SKDVLDELKNYISKR
Chain B sequence:
GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDP
ETSSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQ
VKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIF
DKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA
member of: CATH:search1.10.150.190/search2.40.50.140GENE3D:searchG3DSA_1.10.150.190/searchG3DSA_2.40.50.140PANTHER:searchPTHR10602/searchPTHR10602_SF0PFAM:searchPF00575/searchPF07541PROSITE PROFILES:searchPS50126, SMART:searchSM00316SUPERFAMILY:searchSSF116742/searchSSF50249UniProt:searchP20459
sec str:  .................eeeeeeeee...eeeeee......eeeee..........eeeeeeeeee....eeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh...
sequence :  ..SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLS..LIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
seq num:  ..3         13        23        33        43    ..61        71        81        91        101       111       121       131       141       151       161       171  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |     | |  |      ||                       ..  |  |      || | || |   ||**^*  |                        | ||  |         | |          |  | | || |               | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |     | |  |      ||                       ..  |  |      || | || |   ^** ||  |                        | ||  |         ^**          |  | | || |               ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |     | |  |      ||                       ..  |  |      || | || |    |  |^***                        | ||  |                      ^*** ^*** |                  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   ******^ |  |      ||                       ..  |  |      |*******^    |  |                            | ||  |                      |  | | || |                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****       |  |      ||                       ..  |  |      || | || |    |  |                            | ||  |                      |  | | || |                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |      ||                       ..  |  |      || ***| |    |  |                            | ||  |                      |  *** || |                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |      **                       ..  |  |      ** |  | |    |  |                            | ||  |                      |  | | || |                  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           |  |                               ..  |  |         ******    |  |                            | ||  |                      |  | | || |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |                               ..  |  |            | |    |  |                            | |****                      |  | **** |                  
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |                               ..  |  |            ***    |  |                            ***                          |  | | || |                  
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                               ..  ****                   ****                                                         **** ******                  

chain B : INTERFERON-INDUCED, DOUBLE-STRANDED RNA-ACTIVATEDKINASE;
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR11042/searchPTHR11042_SF77PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SUPERFAMILY:searchSSF56112UniProt:searchP19525
sec str:  .......hhhhhhheeeeeeeee...eeeeeeee.....eeeeeeee..hhhhhhhhhhhh.........eeeeeeeeee..........eeeeeeeeee.....hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.eee...hhh.eeeee..eeee.....eee.................hhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh.
sequence :  ..GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETS..SRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
seq num:  ..255       265       275       285       295       305       315       325          ..355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |   |  |  |  ||          |   | | |  |     | |      || || |  |    |    |  | |||..**                |   |   |  |  |   |               ||||   | || ||   |  | |  ||| | ||| |  |     ||| | |   || |          |    |  |   |  || |          |  |         |  | ||  | ^*** |   |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |   |  |  |  ||          |   | | |  |     | |      || || |  |    |    |  | ||^..**                |   |   |  |  |   |               ^**|   | || ||   |  | |  ||| | ^** |  |     ^** | |   || |          |    |  |   |  |^**          |  |         |  ^**|  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |   |  |  |  ||          |   | | |  |     | |      || || |  |    |    |  | |||..                  |   |   |  |  |   |                | |   | || ||   |  | |  ||| | ||| |  |     ||| | |   ^***          |    |  |   ^***|            |  |         |  | ||  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  | |   |  |  |  ||          ********^  |     | |      || || |  |    |    |  | |||..                  |   |   |  |  |   |                | |   | || ||   |  | |  ||| | ||| |  |     ||| | |   || |          |    |  |   |   |            |  |         |  | ||  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  | |   |  |  |  ||              | |    |     | |      || || |  |    ^*****  | |||..                  |   |   |  |  |   |                | |   | || ||   |  | |  ||^*****| |  |     ||| | |   || |          ^*****  |   |   |            |  |         |  | ||  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|  | |   |  |  |  ||              | |    |     | |      || || |  |            | |||..                  |   |   |  |  |   |                | |   | || ||   |  | |  ||  | | | ^***     ||| | |   || |               |  |   |   |            |  |         |  | ||  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..|  | |   |  |  |  ************************     | |      || || |  |            | |||..                  |   |   |  |  |   |                | |   | || ||   |  | |  ||  | | | |        ||| | |   || |               |  |   |   |            |  |         |  | ||  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  | |   |  |  |  ||              | |          | |      ***** |  |            | |||..                  |   |   |  |  |   |                | |   | || ||   |  | |  ||  | | | |        ||| | |   || |               |  |   |   |            |  |         |  | ||  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  | |   |  |  |  ||              | |          | |      || || |  |            | |||..                  |   |   |  |  *****                | |   | || ||   |  | |  ||  | | | |        ||| | |   || |               |  |   |   |            |  |         |  | ||  | | |  |   |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  | |   |  |  |  ||              ***          ***      || || |  |            ***||..                  |   |   |  |                       | |   | || ||   |  | |  ||  | | | |        ||| | |   || |               |  |   |   |            |  |         |  | ||  | ***  |   |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  | |   |  |  |  **              | |                   || || |  |            | |||..                  |   |   |  |                       | |   | || ||   |  | |  ||  | | | |        ||| | |   || |               |  |   |   |            |  |         |  | ||  |      |   |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  | |   |  |  |                  | |                   ***** |  |            | |||..                  |   |   |  |                       | |   | || ||   |  | |  |**** | | |        ||| | |   || |               |  |   |   |            |  |         |  | ||  |      |   |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  | |   |  |  |                  | |                    |  | |  |            | ***..                  |   |   |  |                       | |   | || ||   |  | |  ||  | | ***        ||| | |   || |               |  |   |   |            |  |         |  | ||  |      |   |    
search RasMol script viewer Motif-ligand binding stats  nest ..|  | |   |  |  |                  ***                    |  | |  |            |  | ..                  |   |   |  |                       ***   | || ||   |  | |  ||  | | |          ||| | |   || |               |  |   |   |            |  |         |  | ||  |      |   |    
search RasMol script viewer Motif-ligand binding stats  niche ..******   *******                                         **** ****            **** ..                  |   |   ****                             | |****   **** |  |**** ***          ***** |   || |               ****   |   |            ****         **********      |   |    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                   ..                  *****                                    | |  |       | |  |                  |     |   || |                      *****                                         |   |    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                   ..                                                           | |  |       | |  |                  |     *****| |                      *****                                         *****    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                   ..                                                           | |  |       | |  |                  |          ***                                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                   ..                                                           * *  *       * *  *                  *            *                                                                             

   New search    2a1a:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors