triangle PDBeMotif: 1zy3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification apoptosis    | release date: Thu, Jun 9, 2005
Title structural model of complex of bcl-w protein with bid bh3- peptide
Authors A.Y.DENISOV, K.GEHRING
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQ
VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARR
LREGNWASVRLEHHHHHH
Chain B sequence:
IIKNIARHLAQVGDSMDRSI
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | ||||||||||||||    ||    |      |||||||| || |  |||| ||  |||| |   |  ||| |||||  || |  || |||| |||||| |  | |     ||||||||||||  ||||||| ||| || |   | |        |  |^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** ||||||||||||||    ||    |      |||||||| || |  |||^***  |||| |   |  ||| |||||  || |  || |||| |||||| |  | |     ||||||||||||  ||||||| ||| || |   | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | ||||||||||||||    |^*****      |||||||| || |  |||  ||  |||| |   |  ||| |||||  || |  || |||| ^***** |  | |     ||||||||||||  ||||||| ||| || |   | |        ^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | ||||||||||||||    |            |||||||| || |  |||  ||  |||| |   |  ||| |||********************|||| |  | |     ||||||||||||  ||||||| ||| || |   | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | ||||||||||||||    |            |||||||| || |  |||  ||  |||| |   |  ||| ||| |  || |  || ||||  ||||| |  | |     ||||||||||||  ||************ |   | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************            |||||||| || |  |||  ||  |||| |   |  ||| ||| |  || |  || ||||  ||||| |  | |     ||||||||||||  ||||||| ||| || |   | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |*************                 *********** **************|| |   ********** |  || *********|  ||||| |  | |     ***********|  ******* ||| || |   | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***|||||||||||||                 |||||||| |  |  | |  ||  | || |   |  ||| ||  |  || |  || || |  ||||| |  | |     ||||||||||||  ||||||| ||| || |   | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          *************                 **********  **** *********** |   *********  ****| ******** ******** **** |     ***********|  ******* ||******   | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                                  |  |                  ***             |   |  | |            |   |        | ||   |     | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                  |  |                                  |   |  ***            |   |        ***|   |     | |        |  ||| 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                  ****                                  |   |                 |   |        ***|   |     ***        |  *** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                        *****                 *****           *****                *****  

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..   |*************** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ***********||  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **************** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | | |  |||||||||    ||   ||| | | |  |  |  || |  |||| ||  || |||   || |||  | |          || |||||||||| ||||||    |  | ||||||||   ||| || | | || |  |    |  |  |||| ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** | |  |||||||||    ||   ||| | | |  |  |  || |  |||^***  || |||   || |||  | |          || |||||||||| ||||||    |  | ||||||||   ||| || | | || |  |    |  |  ||||  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | | |  |||||||||    |^*****| | | |  |  |  || |  |||| ||  || |||   || |||  | |          || ||||^***** ||||||    |  | ||||||||   ||| || | | || |  |    |  |  |^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | | |  |||||||||    |    | | | | |  |  |  || |  |||| ||  || |||   || |||  | ********************|||| ||||||    |  | ||||||||   ||| || | | || |  |    |  |  ||||    
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | | |  |||||||||    |    | | | | |  |  |  || |  |||| ||  || |||   || |||  |            || |||||||||| ||||||    |  | ||||||||   |************ |  |    |  |  ||||    
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************    | | | | |  |  |  || |  |||| ||  || |||   || |||  |            || |||||||||| ||||||    |  | ||||||||   ||| || | | || |  |    |  |  ||||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | | ************         | | | | |  |  ***** **********  *****|   |*****  |            |*****||||||*****|||    |  ********||   |***** | | || |  |    |  |  ||||    
search RasMol script viewer Motif-ligand binding stats  asxturn ..       *** |  |||||||||         | | | | |  |  |  |  |  | || ||  || | |   || ||   |            || |||||||||| || |||    |  | || || ||   ||| || | | || |  |    |  |  ||||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ************         | | | | **********  **** *********** |   *****   |            *******************|    ************|   |***** | ******  |    |  |  ||||    
search RasMol script viewer Motif-ligand binding stats  nest ..                                | | | |                          |   |       |   |                      |   |  ***            |   |   |   |***      |  |    |  |  ****    
search RasMol script viewer Motif-ligand binding stats  niche ..                                *** ***                          |   |       |   |                      |   |    |            |   |   |   |***      ****    ****          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                 |   |       |   |                      |   ******            |   |   |   |                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                 *****       *****                      *****                 *****   *****                               

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..    *************** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ********|     
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | | |  || ||| || || ||    |  | | |  || || || || | || ||  |||| |     |  |  |||||||  |  || |||||||||||||||||| |  || |  ||        |||||| |   || |  |   |  ||   |   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** | |  || ||| || || ||    |  | | |  || || || || | |^***  |||| |     |  |  |||||||  |  || |||||||||||||||||| |  || |  ||        |||||| |   || |  |   |  ||   |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | | |  || ||| || || |^*****  | | |  || || || || | |  ||  |||| |     |  |  |||||||  |  || |||||^*****||||||| |  || |  ||        |||||| |   || |  |   |  ||   ^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | | |  || ||| || || |        | | |  || || || || | |  ||  |||| |     |  |  ||********************||||||||||| |  || |  ||        |||||| |   || |  |   |  ||          
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | | |  || ||| || || |        | | |  || || || || | |  ||  |||| |     |  |  || ||||  |  || ||||| |||||||||||| |  || |  ||        |************ |  |   |  ||          
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************        | | |  || || || || | |  ||  |||| |     |  |  || ||||  |  || ||||| |||||||||||| |  || |  ||        | |||| |   |  |  |   |  ||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | | ***************          | | |  ******** || | *********|| |     |  *********|  *********|************|| ***** *****        *****| |   |  |  |   *****          
search RasMol script viewer Motif-ligand binding stats  asxturn ..       *** |  || ||| || |           | | |  || || |  || | |  ||  | || |     |  |  || || |  |  || || || |||||||||||| |  |  |  |         | || | |   |  |  |   |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..           **************           | | **********  **** *********** |     *************  ***********************| ****  ****         ****** |   ****  |   ****           
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |          |   |            |  |                                      |  ***                         ***      |  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***          |   |            ****                                      |    |                         ***      ****                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                 |   |                                                      ******                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                                                                                                                    

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 .. |  *************** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****|  || | || |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. **** ****| **** |  
search RasMol script viewer Motif-ligand binding stats  niche ..          |   ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | |   |||||||||| || ||    |  | | |  |  |     |  |||| ||  | || | |     ||  |||      |  |||  ||||||| |||||| | |  || |||| ||| ||   |  || |    |     |  |       |   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** |   |||||||||| || ||    |  | | |  |  |     |  |||^***  | || | |     ||  |||      |  |||  ||||||| |||||| | |  || |||| ||| ||   |  || |    |     |  |       |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |   |||||||||| || |^*****  | | |  |  |     |  |||| ||  | || | |     ||  |||      |  |||  |||^*****||||| | |  || |||| ||| ||   |  || |    |     |  |       ^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | |   |||||||||| || |        | | |  |  |     |  |||| ||  | || | |     ||  ||********************|| |||||| | |  || |||| ||| ||   |  || |    |     |  |              
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | |   |||||||||| || |        | | |  |  |     |  |||| ||  | || | |     ||  ||       |  |||  |||  || |||||| | |  || |||| ||| ||   ************     |  |              
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************        | | |  |  |     |  |||| ||  | || | |     ||  ||       |  |||  |||  || |||||| | |  || |||| ||| ||   |  || |          |  |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |   |************          | | |  |  |     **********  | || | |     |*****       *************** |||||| | *****************   ***** |          |  |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***   ||||||| || |           | | |  |  |     |  | || ||  | || | |     ||  |        |  | |  | |  || |||||| | |  || |||| ||  |    |  || |          |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ************           | | *******     **** *********** | |     |****        **** **** ************ | ****************    ****| |          |  |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                    | |                           |  ***     |   |                      |   |  | |                         | |          |  |              
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |                           |  |       |   |                      |   |  ***                         ***          |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                           ****       |   |                      |   |                              ***          ****              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                             *****                      *****                                                             

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..    *************** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ********* |**** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | ||||||||||||||||| ||    |  | | ||||||||||| ||||| |  ||||||| |   || |||  ||| ||      |  || ||||||||||||||| |  |||| |||||||||   ||  | ||  || |       |  |   |   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** ||||||||||||||||| ||    |  | | ||||||||||| ||||| ^***|||||| |   || |||  ||| ||      |  || ||||||||||||||| |  |||| |||||||||   ||  | ||  || |       |  |   |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | ||||||||||||||||| |^*****  | | ||||||||||| |||||     |||||| |   || |||  ||| ||      |  || ||^*****||||||| |  |||| |||||||||   ||  | ||  || |       |  |   ^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | ||||||||||||||||| |        | | ||||||||||| |||||     |||||| |   || |||  ||********************||||||||||| |  |||| |||||||||   ||  | ||  || |       |  |          
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | ||||||||||||||||| |        | | ||||||||||| |||||     |||||| |   || |||  ||  ||      |  || ||||||||||||||| |  |||| |||||||||   ************ |       |  |          
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************        | | ||||||||||| |||||     |||||| |   || |||  ||  ||      |  || ||||||||||||||| |  |||| |||||||||   ||  | ||  || |       |  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |****************          | | *****************     |||||| |   *****|  |*****      ***** ||||||||*****|| *****************   ||  | ||  || |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***||||||||||||| |           | | |||||||| || || |      |||||| |   || |||  ||  |       |  |  ||||||||||||||| |  | || |||||| |    ||  | ||  || |       |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ***************           | | ****************      ********   ****||  |****       ********************| **** ***********    |**** ||  ****       |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |                           |  |    |  ||  |                      |   |  ***            |   |    |   ***|   |         |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                           ****    |  ||  |                      |   |                 |   |    |   ***|   |         ****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                          ********                      *****                 *****    *****  *****                       

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..   |***************|
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ******** *****|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *******| *******|
search RasMol script viewer Motif-ligand binding stats  nest ..          |   |  ***
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | ||  |||||||||| || ||    |  | | |  |  |  ||||||| || ||  | || |    |  ||  ||| |       || |||  ||| ||| |||||      || ||||||||| ||||||| | || |||  |       |||||  |^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** ||  |||||||||| || ||    |  | | |  |  |  ||||||| |^***  | || |    |  ||  ||| |       || |||  ||| ||| |||||      || ||||||||| ||||||| | || |||  |       |||||  | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | ||  |||||||||| || |^*****  | | |  |  |  ||||||| |  ||  | || |    |  ||  ||| |       || |||  ^*****| |||||      || ||||||||| ||||||| | || |||  |       ||||^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | ||  |||||||||| || |        | | |  |  |  ||||||| |  ||  | || |    |  ||  ||********************| ||| |||||      || ||||||||| ||||||| | || |||  |       ||||   | | 
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | ||  |||||||||| || |        | | |  |  |  ||||||| |  ||  | || |    |  ||  ||  |       || |||   || ||| |||||      || ||||||||| ||************||  |       ||||   | | 
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************        | | |  |  |  ||||||| |  ||  | || |    |  ||  ||  |       || |||   || ||| |||||      || ||||||||| ||||||| | || |||  |       ||||   | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |****************          | | |  |  |  |*****| *****  | || |    *****  ||  |       ******   |*********||      ************ |****** | |*****  |       ||||   | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***|  ||||||| || |           | | |  |  |  ||||||| |  ||  | || |    |  |   ||  |       || ||    || ||| |||||      || ||||||||  ||||||| | || |||  |       ||||   | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ***************           | | *******  |****** *********** |    ****   |****       *****    ***********|      ***********  ******* | *****|  |       ||||   | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                    | |          |   |            |  |       |   |                             | |                         | |      |  |       ***|   | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |          |   |            |  |       |   |                             ***                         ***      |  |        | |   | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***          |   |            ****       |   |                                                         ***      ****        ***   *** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                       *****                                                                                        

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..    *************** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *********     

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | |||  ||| ||| |    ||    |  | | || ||||| ||  ||  || ||| |||| |    |   |    |    | |  |  || ||||||||||||| |      || ||||| ||   |||||| |||  | |  | | |       |   ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** |||  ||| ||| |    ||    |  | | || ||||| ||  ||  |^***| |||| |    |   |    |    | |  |  || ||||||||||||| |      || ||||| ||   |||||| |||  | |  | | |       |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |||  ||| ||| |    |^*****  | | || ||||| ||  ||  |  ||| |||| |    |   |    |    | |  |  || ||^*****||||| |      || ||||| ||   |||||| |||  | |  | | |       ^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | |||  ||| ||| |    |        | | || ||||| ||  ||  |  ||| |||| |    |   |    ********************||||||||| |      || ||||| ||   |||||| |||  | |  | | |              
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | |||  ||| ||| |    |        | | || ||||| ||  ||  |  ||| |||| |    |   |         | |  |  || || |||||||||| |      || ||||| ||   |************ |  | | |              
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************        | | || ||||| ||  ||  |  ||| |||| |    |   |         | |  |  || || |||||||||| |      || ||||| ||   |||||| |||  | |  | | |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ************** |             | | |**************  **********| |    |   |         | |  ***** || |********| |      ******|| ||   |***** |||  | |  | | |              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       *****  ||| ||  |             | | || || || ||  |   |  ||| |||| |    |   |         | |  |  |  || ||||| || | |      || || || ||   |||||| |||  | |  | | |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***||  ||| ||  |             | | || || || ||  |   |  ||| |||| |    |   |         | |  |  |  || ||||| || | |      || || || ||   |||||| |||  | |  | | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****************             | | **************   *********** |    |   |         | |  ******************* |      ***** *****   ****** ||**** |  | | |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                    | |                           |  |    |   |         ***             |   |  | |            |   |        | ||   | |  | ***              
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |                           |  |    |   |                         |   |  ***            |   |        ***|   | |  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                           ****    |   |                         |   |                 |   |        ***|   | ****                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                          *****                         *****                 *****           *****                       

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..   |***************|
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****  |   || |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *****  |   |****|
search RasMol script viewer Motif-ligand binding stats  nest ..          |   |  ***
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | ||| ||||||||||||  ||    |  | | ||||||||  |  |   || ||  | ||||      |||| ||| ||         |  |||||||| |||||| |  || |||||||||||  |||||||||  || |  ||||        |  |^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** ||| ||||||||||||  ||    |  | | ||||||||  |  |   |^***  | ||||      |||| ||| ||         |  |||||||| |||||| |  || |||||||||||  |||||||||  || |  ||||        |  | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | ||| ||||||||||||  |^*****  | | ||||||||  |  |   |  ||  | ||||      |||| ||| ||         |  ||^***** |||||| |  || |||||||||||  |||||||||  || |  ||||        ^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | ||| ||||||||||||  |        | | ||||||||  |  |   |  ||  | ||||      |||| ||********************|||| |||||| |  || |||||||||||  |||||||||  || |  ||||           | | 
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | ||| ||||||||||||  |        | | ||||||||  |  |   |  ||  | ||||      |||| ||  ||         |  |||||||| |||||| |  || |||||||||||  |************ |  ||||           | | 
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************        | | ||||||||  |  |   |  ||  | ||||      |||| ||  ||         |  |||||||| |||||| |  || |||||||||||  |||||||||  || |  ||||           | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | ||*************|           | | |||*****  |  |   *****  *****|      ||*********         ***************||| *****************  *****||||  || |  ||||           | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***|| |||||||||| |           | | ||||||||  |  |   |  |   | || |      |||| ||  |          |  |||||||| || ||| |  || || ||||| |   |||||||||  || |  ***|           | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ***************           | | ********  ****   ****   **** |      **********          *****************| ****************   *******||  ****  ||||           | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |                           |  |       |   |                      |   |  ***            |   |     |  ***|   |    ****           | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                           ****       |   |                      |   |                 |   |     |  ***|   |                   *** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                             |   |                      |   |                 |   |     ******|   |                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                             *****                      *****                 *****           *****                       

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..   |***************|
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *******|  ||| |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ***********|****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |   |  ***
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  | ||| ||||||||||    ||    |  | | |  || |     |  |||| ||  ||||||     | ||| ||| ||      |  || | ||  || ||||||      || || ||||    |||||| ||| |||| || | |       |  |^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** ||| ||||||||||    ||    |  | | |  || |     |  |||^***  ||||||     | ||| ||| ||      |  || | ||  || ||||||      || || ||||    |||||| ||| |||| || | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | ||| ||||||||||    |^*****  | | |  || |     |  |||  ||  ||||||     | ||| ||| ||      |  || | ^***** ||||||      || || ||||    |||||| ||| |||| || | |       ^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..       | ||| ||||||||||    |        | | |  || |     |  |||  ||  ||||||     | ||| ||********************  || ||||||      || || ||||    |||||| ||| |||| || | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  BH2 ..       | ||| ||||||||||    |        | | |  || |     |  |||  ||  ||||||     | ||| ||  ||      |  || |  |  || ||||||      || || ||||    |************|| || | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..       *********************        | | |  || |     |  |||  ||  ||||||     | ||| ||  ||      |  || |  |  || ||||||      || || ||||    | |||| ||| |||| || | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | ||************             | | ***** |     *****************|     ***** |*****      ***** |  |  |*****|||      *********|    *****| ||| |||| || | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ***|| ||||||||||             | | |  |  |     |  | |  ||  | || |     | ||  ||  |       |  |  |  |  || || |||      || || || |    | || | ||| |||| || | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          *************             | | *******     **** *********** |     ****  |****       *******  ***********|      **********    ****** ||********| | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                                    | |                           |  |       |   |                          |  ***                         ***|   | |  | | |       |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                           ****       |   |                          |    |                         ***|   | **** ***       ****** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                             |   |                          ******                            |   |                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                             *****                                                            *****                       

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..   |***************|
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****  |  ||  | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****   ****|  | |
search RasMol script viewer Motif-ligand binding stats  nest ..          |   |  ***
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****     

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS REGULATOR BCL-W
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF13PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLW/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01258/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854UniProt:searchQ92843
sec str:  .........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhh....................
sequence :  ..ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | || ||  ||||||||||    ||    |  | | |||||||  || || || |  || |||| |   || |||  ||| |  |    ||||||| ||||||||||||| |  |||| |||||||||   |  || |  |||||       |  || || | ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^*** ||  ||||||||||    ||    |  | | |||||||  || || || ^***| |||| |   || |||  ||| |  |    ||||||| ||||||||||||| |  |||| |||||||||   |  || |  |||||       |  || || | || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | || ||  ||||||||||    |^*****  | | |||||||  || || || |  || |||| |   || |||  ||| |  |    ||||||| ^*****||||||| |  |||| |||||||||   |  || |  |||||       |  || |^***** 
search RasMol script viewer Motif-ligand binding stats  BH1 ..    | || ||  ||||||||||    |        | | |||||||  || || || |  || |||| |   || |||  ||********************||||||||||| |  |||| |||||||||   |  || |  |||||       |  || |  | |  
search RasMol script viewer Motif-ligand binding stats  BH2 ..    | || ||  ||||||||||    |        | | |||||||  || || || |  || |||| |   || |||  ||  |  |    |||||||  |||||||||||| |  |||| |||||||||   ************||       |  || |  | |  
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..    | |*********************        | | |||||||  || || || |  || |||| |   || |||  ||  |  |    |||||||  |||||||||||| |  |||| |||||||||   |  || |  || ||       |  || |  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | || |*****|*******             | | |*****|  || ***** ***** |||| |   || |||  ||  |  |    *******  *****||||||| *****************   ***** |  || ||       |  || |  | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |***|  |||||||||              | | |||||||  || || |  |  || |||| |   || |||  ||  |  |    |||||||  |||||||||||| |  | || |||||| |    |  || |  || ||       |  || |  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |   ************              | | ****************  ********** |   *****|  |*******    *******  ***********| **** ***********    ****| |  *****       |  || |  | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |                             | |          |   |            |  |    |  ||  |                      |   |  | |            |   |        | |              |  |***  | |  
search RasMol script viewer Motif-ligand binding stats  nest ..    | |                             | |          |   |            |  |    |  ||  |                      |   |  ***            |   |        ***              |  |     | |  
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                             ***          |   |            ****    |  ||  |                      |   |    |            |   |        ***              ****     ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                 |   |                    |  ||  |                      |   ******            |   |                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                    ********                      *****                 *****                                       

chain B : BH3-PEPTIDE FROM BH3 INTERACTING DOMAIN DEATHAGONIST PROTEIN;
member of: GENE3D:searchG3DSA_1.10.437.10PFAM:searchPF06393PIRSF:searchPIRSF038018PROSITE PATTERNS:searchPS01259, SUPERFAMILY:searchSSF56854UniProt:searchP55957
sec str:  ...hhhhhhhhhhhhhhhhh..
sequence :  ..IIKNIARHLAQVGDSMDRSI
seq num:  ..201       211       
search RasMol script viewer Motif-ligand binding stats  BH3 ..   |*************** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *********  ***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ********   ***** 

   New search    1zy3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML