triangle PDBeMotif: 1zvm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.2.5
Classification hydrolase    | release date: Thu, Jun 2, 2005
Title crystal structure of human cd38: cyclic-adp-ribosyl syntheta glycohydrolase
Authors A.SAUVE, S.C.ALMO, T.YANG, V.L.SCHRAMM, W.SHI
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
RWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 302A  ..                                                                                                                                                                      **                                                                                    
JMol viewer RasMol script viewer  SO4 301A  ..                                                                                 *                                                                                    ||      **                                                                            
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhh.........eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh.......
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCT
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**|   |    |   |   | || |   |  | | |||| |  | |||||||  ||  |    |  |                |  | |||||   | || |       ^**    |  |   |       |   | ^** |  |        | || | ||  |   | || || |  |          | |    |  | ^**| || |^** |  ^**                |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     |   |    |   |   | || |   ^*** | |||| |  | |^***||  ||  |    |  |                |  | ^***|   | || |       | |    ^***   |       |   |     |  |        | || | ||  |   | || || |  |          | |    |  | ^*** || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     |   |    |   |   | || |        | ^*****  | | || ||  ||  |    |  |                |  | |||||   | || |       | |       |   |       |   |     |  |        | || | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     |   |    |   |   | || |        | |||| |  | | *****  ||  |    |  |                |  | |||||   | || |       | |       |   |       |   |     |  |        | || | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |     |   |    |   |   | || |        | |||| |  | | || ||  ||  |    |  |                |  | |||||   | || |       | |       *****       |   |     |  |        | || | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |     |   |    |   |   | || |        | |||| |  | | || ||  ||  |    |  |                |  | |||||   | || |       | |                   |   |     |  |        ***| | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     |   |    |   |   ******        ****|| |  | | *****  ||  |    |  |                **** ****|   | ****       | |                   |   |     |  |        |  | | ||  |   | ****| |  |          | |    ****   |  || **** |                     |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |     |   |    |   |     |  |          | || |  | |        ||  |    |  |                |  |  || |   | || |       | |                   |   |     |  |        |  | | ||  |   | ||  | |  |          | |    |  |   |  ||  | ***                     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***     |   |    |   |     ****          ******  ***        |****    ****                ****  ****   ******       ***                   |   |     ****        **** *******   | |**** ****          ***    ****   |  ||  |                         **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..            |   |    |   |                                      |   |                               | *****                                  |   |                            |   | |                                 |  ||  |                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****    *****                                      *****                               |                                        *****                            ***** |                                 ********                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 304B  ..                                                                                                                                                                      **                                                                                    
JMol viewer RasMol script viewer  SO4 303B  ..                                                                                 *                                                                                    ||       *                                                                            
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhh.........eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh.......
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCT
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**         |   |  |  |  ||  || | | |||| |  | || || |   |  |    |  |         | | ||||  | |||||   | || |       ^**    |  |                 ^** |  |        | ||    | |||  | ||  ||| ||          | |    |  | ^**|    |^** |  ^**                |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |              |   |  |  |  ||  ^*** | |||| |  | |^*** |   |  |    |  |         | | ||||  | ^***|   | || |              ^***                     |  |        | ||    | |||  | ||  ||| ||          | |    |  | ^***    |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |              |   |  |  |  ||  ||   | ^*****  | |  |  |   |  |    |  |         | | ||||  | |||||   | || |                                       |  |        | ||    | |||  | ||  ||| ||          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |              |   |  |  |  |*****   | |||| |  | |  |  |   |  |    |  |         | *****|  | |||||   | || |                                       |  |        | ||    | |||  | ||  |*****          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |              |   |  |  |  ||  |    | |||| |  | |  |  |   |  |    |  |         | | || |  | |||||   | || |                                       |  |        | ||    *****  | ||  ||| ||          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |              |   |  |  |  ||  |    | |||| |  | |  |  |   |  |    |  |         | | || |  | |||||   | || |                                       |  |        ***|    ***|   | ||  ||| ||          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |              |   |  |  |  |****    ****|| |  | |  ****   |  |    |  |         | **** |  | ****|   | ****                                       |  |        |  |    ****   | ||  |****|          | |    ****         **** |                     |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |              |   |  |  |  |          | || |  | |         |  |    |  |         |   |  |  |  || |   | || |                                       |  |        |  |    |  |   | ||  | |  |          | |    |  |            ***                     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***              |   ****  ****          ******  ***         ****    ****         |   |  ****  ****   ******                                       ****        ****    ****   | |**** ****          ***    ****                                    **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     |   |                                                            |   |         |                                                                         ***** |                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****                                                            *****         |                                                                               |                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                       

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 306C  ..                                                                                                                                                                      **                                                                                     
JMol viewer RasMol script viewer  SO4 305C  ..                                                                                 *                                                                                    ||      **                                                                             
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhh.eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh........
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTS
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**|   |    |   |  || || |   |  |   | || || |||||||||  ||  |    |  |                |  | |||||   | || |       ^**    |  |   |             ^** |  |        | || | ||  |   | || |||| ||          | |   ||| | ^**| |  |^**||  ^**                |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     |   |    |   |  || || |   ^***   | || || |||^***||  ||  |    |  |                |  | ^***|   | || |       | |    ^***   |                 |  |        | || | ||  |   | || |||| ||          | |   ||| | ^*** |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     |   |    |   |  || || |          ^*****| |||||| ||  ||  |    |  |                |  | |||||   | || |       | |       |   |                 |  |        | || | ||  |   | || |||| ||          | |   ||| |  ||  |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     |   |    |   |  || || |          | || || |||||| ||  ||  |    |  |                |  | |||||   | || |       | |       |   |                 |  |        | || | ||  |   | || ||*****          | |   ||| *****  |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |     |   |    |   |  || || |          | || || |||||| ||  ||  |    |  |                |  | |||||   | || |       | |       *****                 |  |        | || | ||  |   | || |||| ||          | |   ||| |  |   |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |     |   |    |   |  || || |          | || || |||||| ||  ||  |    |  |                |  | |||||   | || |       | |                             |  |        ***| | ||  |   | || |||| ||          | |   *** |  |   |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     |   |    |   |  |**** |          | || |****||*****  ||  |    |  |                **** ****|   | ****       | |                             |  |        |  | | ||  |   | ****|****|          | |    |  ****   |  *****|                     |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..    | |     |   |    |   |  |  |  |          | || |  | || |     ||  |    |  |                |  |  || |   | || |       | |                             |  |        |  | | ||  |   | ||  | |  |          | |    |  |      |   | ***                     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..    ***     |   |    |   ****  ****          ******  ***| |     |****    ****                ****  ****   ******       ***                             ****        **** *******   | |**** ****          ***    ****      |   |                         ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****    *****                              | |     *****                               |                  | |                                                    ***** |                                    *****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                        ***                                         |                  ***                                                          |                                                                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                        

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 308D  ..                                                                                                                                                                      **                                                                                    
JMol viewer RasMol script viewer  SO4 307D  ..                                                                                 *                                                                                    ||      **                                                                            
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh..........hhhhhhhhhhhh...hhhh.eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhh..eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh.......
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCT
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**|   |    |   |   | || ||  || |   | || |  | || || |   |  |   || ||      |  |||| |||  | |||||   | || |       ^**    |  |           | | | ^** |  |        |  |    | |||  | ||  |              ||||   ||| | ^**|    |^** |  ^**                |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     |   |    |   |   | || ||  ^***   | || |  | |^*** |   |  |   || ||      |  |||| |||  | ^***|   | || |       | |    ^***           | | | |   |  |        |  |    | |||  | ||  |              ||||   ||| | ^***    |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     |   |    |   |   | || ||  ||     ^*****  | |  |  |   |  |   || ||      |  |||| |||  | |||||   | || |       | |                   | | | |   |  |        |  |    | |||  | ||  |              ||||   ||| |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     |   |    |   |   | || |*****     | || |  | |  |  |   |  |   || ||      ***********  | |||||   | || |       | |                   | | | |   |  |        |  |    | |||  | ||  |              ||||   ||| |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |     |   |    |   |   | || ||  |      | || |  | |  |  |   |  |   || ||      |  | || |||  | |||||   | || |       | |                   | | | |   |  |        |  |    *****  | ||  |              ||||   ||| |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |     |   |    |   |   | || ||  |      | || |  | |  |  |   |  |   || ||      |  | || |||  | |||||   | || |       | |                   | | | |   |  |        |  |    ***|   | ||  |              ||||   *** |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     |   |    |   |   **********      | || |  | |  ****   |  |   ****|      **** *****|  | ****|   | || |       | |                   | | | |   ****        |  |    ****   | ||  |              ||||    ****         **** |                     |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |     |   |    |   |     |  |          | || |  | |         |  |    |  |                |  |  || |   | || |       | |                   | | | |   |  |        |  |    |  |   | ||  |              ****    |  |            ***                     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***     |   |    |   |     ****          ******  ***         ****    ****                ****  ****   ******       ***                   | | | |   ****        ****    ****   | |****               ***    ****                                    **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****    *****                                                                          |                  | |                   *******                          ***** |                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    |                  ***                                                          |                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                       

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 306C  ..                                                                                                                                      **                              **                                                                                     
JMol viewer RasMol script viewer  SO4 305C  ..                                                                                 *                                                 ** ||                              ||      **                                                                             
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhh.eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh........
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTS
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**|   |    |   |  || || |   |  |   | || || |||||||||  ||  |    |  |                |  | |||||   | || |       ^**    |  |   |             ^** |  |        | || | ||  |   | || |||| ||          | |   ||| | ^**| |  |^**||  ^**                |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     |   |    |   |  || || |   ^***   | || || |||^***||  ||  |    |  |                |  | ^***|   | || |       | |    ^***   |                 |  |        | || | ||  |   | || |||| ||          | |   ||| | ^*** |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     |   |    |   |  || || |          ^*****| |||||| ||  ||  |    |  |                |  | |||||   | || |       | |       |   |                 |  |        | || | ||  |   | || |||| ||          | |   ||| |  ||  |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     |   |    |   |  || || |          | || || |||||| ||  ||  |    |  |                |  | |||||   | || |       | |       |   |                 |  |        | || | ||  |   | || ||*****          | |   ||| *****  |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |     |   |    |   |  || || |          | || || |||||| ||  ||  |    |  |                |  | |||||   | || |       | |       *****                 |  |        | || | ||  |   | || |||| ||          | |   ||| |  |   |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |     |   |    |   |  || || |          | || || |||||| ||  ||  |    |  |                |  | |||||   | || |       | |                             |  |        ***| | ||  |   | || |||| ||          | |   *** |  |   |  || |||                     |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     |   |    |   |  |**** |          | || |****||*****  ||  |    |  |                **** ****|   | ****       | |                             |  |        |  | | ||  |   | ****|****|          | |    |  ****   |  *****|                     |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..    | |     |   |    |   |  |  |  |          | || |  | || |     ||  |    |  |                |  |  || |   | || |       | |                             |  |        |  | | ||  |   | ||  | |  |          | |    |  |      |   | ***                     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..    ***     |   |    |   ****  ****          ******  ***| |     |****    ****                ****  ****   ******       ***                             ****        **** *******   | |**** ****          ***    ****      |   |                         ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****    *****                              | |     *****                               |                  | |                                                    ***** |                                    *****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                        ***                                         |                  ***                                                          |                                                                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                        

Assembly 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 308D  ..                                                                                                                                      **                              **                                                                                    
JMol viewer RasMol script viewer  SO4 307D  ..                                                                                 *                                                 ** ||                              ||      **                                                                            
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh..........hhhhhhhhhhhh...hhhh.eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhh..eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh.......
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCT
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**|   |    |   |   | || ||  || |   | || |  | || || |   |  |   || ||      |  |||| |||  | |||||   | || |       ^**    |  |           | | | ^** |  |        |  |    | |||  | ||  |              ||||   ||| | ^**|    |^** |  ^**                |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     |   |    |   |   | || ||  ^***   | || |  | |^*** |   |  |   || ||      |  |||| |||  | ^***|   | || |       | |    ^***           | | | |   |  |        |  |    | |||  | ||  |              ||||   ||| | ^***    |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     |   |    |   |   | || ||  ||     ^*****  | |  |  |   |  |   || ||      |  |||| |||  | |||||   | || |       | |                   | | | |   |  |        |  |    | |||  | ||  |              ||||   ||| |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     |   |    |   |   | || |*****     | || |  | |  |  |   |  |   || ||      ***********  | |||||   | || |       | |                   | | | |   |  |        |  |    | |||  | ||  |              ||||   ||| |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |     |   |    |   |   | || ||  |      | || |  | |  |  |   |  |   || ||      |  | || |||  | |||||   | || |       | |                   | | | |   |  |        |  |    *****  | ||  |              ||||   ||| |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |     |   |    |   |   | || ||  |      | || |  | |  |  |   |  |   || ||      |  | || |||  | |||||   | || |       | |                   | | | |   |  |        |  |    ***|   | ||  |              ||||   *** |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     |   |    |   |   **********      | || |  | |  ****   |  |   ****|      **** *****|  | ****|   | || |       | |                   | | | |   ****        |  |    ****   | ||  |              ||||    ****         **** |                     |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |     |   |    |   |     |  |          | || |  | |         |  |    |  |                |  |  || |   | || |       | |                   | | | |   |  |        |  |    |  |   | ||  |              ****    |  |            ***                     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***     |   |    |   |     ****          ******  ***         ****    ****                ****  ****   ******       ***                   | | | |   ****        ****    ****   | |****               ***    ****                                    **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****    *****                                                                          |                  | |                   *******                          ***** |                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    |                  ***                                                          |                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                       

Assembly 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 302A  ..                                                                                                                                      **                              **                                                                                    
JMol viewer RasMol script viewer  SO4 301A  ..                                                                                 *                                                 *  ||                              ||      **                                                                            
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhh.........eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh.......
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCT
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**|   |    |   |   | || |   |  | | |||| |  | |||||||  ||  |    |  |                |  | |||||   | || |       ^**    |  |   |       |   | ^** |  |        | || | ||  |   | || || |  |          | |    |  | ^**| || |^** |  ^**                |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |     |   |    |   |   | || |   ^*** | |||| |  | |^***||  ||  |    |  |                |  | ^***|   | || |       | |    ^***   |       |   |     |  |        | || | ||  |   | || || |  |          | |    |  | ^*** || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |     |   |    |   |   | || |        | ^*****  | | || ||  ||  |    |  |                |  | |||||   | || |       | |       |   |       |   |     |  |        | || | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |     |   |    |   |   | || |        | |||| |  | | *****  ||  |    |  |                |  | |||||   | || |       | |       |   |       |   |     |  |        | || | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |     |   |    |   |   | || |        | |||| |  | | || ||  ||  |    |  |                |  | |||||   | || |       | |       *****       |   |     |  |        | || | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |     |   |    |   |   | || |        | |||| |  | | || ||  ||  |    |  |                |  | |||||   | || |       | |                   |   |     |  |        ***| | ||  |   | || || |  |          | |    |  |   |  || || | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |     |   |    |   |   ******        ****|| |  | | *****  ||  |    |  |                **** ****|   | ****       | |                   |   |     |  |        |  | | ||  |   | ****| |  |          | |    ****   |  || **** |                     |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |     |   |    |   |     |  |          | || |  | |        ||  |    |  |                |  |  || |   | || |       | |                   |   |     |  |        |  | | ||  |   | ||  | |  |          | |    |  |   |  ||  | ***                     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***     |   |    |   |     ****          ******  ***        |****    ****                ****  ****   ******       ***                   |   |     ****        **** *******   | |**** ****          ***    ****   |  ||  |                         **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..            |   |    |   |                                      |   |                               | *****                                  |   |                            |   | |                                 |  ||  |                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****    *****                                      *****                               |                                        *****                            ***** |                                 ********                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                       

Assembly 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ADP-RIBOSYL CYCLASE 1
member of: CATH:search1.20.82.10/search3.40.50.720GENE3D:searchG3DSA_1.20.82.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10912/searchPTHR10912_SF5PFAM:searchPF02267SUPERFAMILY:searchSSF52309UniProt:searchP28907
JMol viewer RasMol script viewer  SO4 304B  ..                                                                                                                                      **                              **                                                                                    
JMol viewer RasMol script viewer  SO4 303B  ..                                                                                 *                                                 ** ||                              ||      **                                                                            
sec str:  ........ee....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhh.........eeee.hhhhhhhhhhhh....hhhhhhhhhhhh................ee.........hhhhhhhhhhhhhhhhhh.eeeeeeee..........hhhhhhhhhhh....eeeeeeeee........hhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh.......
sequence :  ..WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCT
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |  ^**         |   |  |  |  ||  || | | |||| |  | || || |   |  |    |  |         | | ||||  | |||||   | || |       ^**    |  |                 ^** |  |        | ||    | |||  | ||  ||| ||          | |    |  | ^**|    |^** |  ^**                |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |              |   |  |  |  ||  ^*** | |||| |  | |^*** |   |  |    |  |         | | ||||  | ^***|   | || |              ^***                     |  |        | ||    | |||  | ||  ||| ||          | |    |  | ^***    |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |              |   |  |  |  ||  ||   | ^*****  | |  |  |   |  |    |  |         | | ||||  | |||||   | || |                                       |  |        | ||    | |||  | ||  ||| ||          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |              |   |  |  |  |*****   | |||| |  | |  |  |   |  |    |  |         | *****|  | |||||   | || |                                       |  |        | ||    | |||  | ||  |*****          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |              |   |  |  |  ||  |    | |||| |  | |  |  |   |  |    |  |         | | || |  | |||||   | || |                                       |  |        | ||    *****  | ||  ||| ||          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |              |   |  |  |  ||  |    | |||| |  | |  |  |   |  |    |  |         | | || |  | |||||   | || |                                       |  |        ***|    ***|   | ||  ||| ||          | |    |  |         |  | |                     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |              |   |  |  |  |****    ****|| |  | |  ****   |  |    |  |         | **** |  | ****|   | ****                                       |  |        |  |    ****   | ||  |****|          | |    ****         **** |                     |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |              |   |  |  |  |          | || |  | |         |  |    |  |         |   |  |  |  || |   | || |                                       |  |        |  |    |  |   | ||  | |  |          | |    |  |            ***                     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***              |   ****  ****          ******  ***         ****    ****         |   |  ****  ****   ******                                       ****        ****    ****   | |**** ****          ***    ****                                    **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     |   |                                                            |   |         |                                                                         ***** |                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****                                                            *****         |                                                                               |                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                               *                                                                       

   New search    1zvm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors