triangle PDBeMotif: 1zv4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Wed, Jun 1, 2005
Title structure of the regulator of g-protein signaling 17 (rgsz2)
Authors A.EDWA, A.HARONITI, A.JANSSON, A.P.TURNBULL, B.MARSDEN, C.ARROWSMITH, CONSORTIUM (SGC), D.A.DOYLE, F.H.NIESEN, F.VON DELFT, G.A.SCHOCH, G.BUNK, J.M.ELKINS, L.BALL, M.SUNDSTROM, O.GILEADI, STRUCTURAL, W.H.LEE, X.YANG
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain X sequence:
MHHHHHHSSGVDLGTENLYFQSMNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKV
IEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain X : REGULATOR OF G-PROTEIN SIGNALING 17
member of: GENE3D:searchG3DSA_1.10.167.10/searchG3DSA_1.10.196.10PANTHER:searchPTHR10845/searchPTHR10845_SF133PFAM:searchPF00615PRINTS:searchRGSPROTEINPROSITE PROFILES:searchPS50132, SMART:searchSM00315SUPERFAMILY:searchSSF48097UniProt:searchQ9UGC6
sec str:  ..........hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...........hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh
sequence :  ..LYFQSMNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISIL..PKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTA
seq num:  ..66        76        86        96        106       116       126       136      ..146       156       166       176       186       196      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||  |  ||  |  |   |  |             ||||           |  | |             |  | |..**|                  | |                    |  |    |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  ||  ^***|  |  |   |  |             ||||           |  | |             |  | |..***                  | |                    |  |    ^***   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  ||  |   |  |  |   |  |             ||||           |  | |             |  | |..                     | |                    |  |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****  |   |  |  |   |  |             ||||           |  | |             |  | |..                     | |                    |  |           
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |   |   |  |  |   |  |             ||||           |  | |             |  | |..                     ***                    |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****   |   |  ****   |  |             ||||           |  | |             |  | |..                                            ****           
search RasMol script viewer Motif-ligand binding stats  nest ..        |   |         |  |             ****           |  | |             |  | |..                                            |  |           
search RasMol script viewer Motif-ligand binding stats  niche ..        |   |         ****                            ******             **** |..                                            ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..        *****                                                               | |..                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                            ***..                                                           

   New search    1zv4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors