triangle PDBeMotif: 1zuc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification hormone/growth factor    | release date: Mon, May 30, 2005
Title progesterone receptor ligand binding domain in complex with the nonsteroidal agonist tanaproget
Authors A.FENSOME, A.M.OLLAND, C.APPAVU, C.R.LYTTLE, J.COHEN, J.WILHEM, J.WROBEL, P.ZHANG, R.C.WINNEKER, R.CHOPRA, R.J.UNWALLA, S.CHIPPARI, S.LI, T.BERRODIN, Y.ZHU, Z.ZHANG
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search T98 T98 binding statistics T98   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains B,A sequence:
GSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYS
WMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEG
LRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIA
AQLPKILAGMVKPLLFHKK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PROGESTERONE RECEPTOR
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084/searchPTHR24084_SF7PFAM:searchPF00104PRINTS:searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP06401
JMol viewer RasMol script viewer  T98 202B  ..                                 *  **     *                              *  **  *  *           *                  *                                                                                            **  *          *                           
sec str:  .....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.ee......hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...ee.....
sequence :  ..QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK
seq num:  ..682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |     | ||||| |                      || || ||| |       |   |        |   ^** | |||   |  |  |  ||  | ||               | ||  |        |  | |  |    |  |              |  | |    ^**|   |                          | |               || |||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |     | |||^***                      || || ||| |       |   |        |   |   | |||   |  |  |  ||  | ||               | |^***        |  | |  |    ^***              |  | |    |  |   |                          | |               || |||        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  |     | |||||                        || || ||| |       |   |        |   |   | |||   |  |  |  *******^               | |            |  | |  |                      |  | |    |  |   |                          | |               || |||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |     | |||||                        || || ||| |       |   |        |   |   | |||   |  |  |   |  | |                | |            |  | |  |                      |  | ^*****  |   |                          | |               || |||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |     | |||||                        ***** ||| |       |   |        |   |   | |||   |  |  |   |  | |                | |            |  | |  |                      |  |         |   |                          | |               || |||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  |     | |||||                        || || ||| |       |   |        |   |   | |||   |  |  *****  | |                | |            |  | |  |                      |  |         |   |                          | |               || |||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |     | |||||                        ********| |       |   |        |   |   ****|   ****         | |                | |            |  | ****                      |  |         |   |                          | |               |****|        
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |     *******                         |  | *** |       |   |        |   |   *****                ***                ***            |  |                           |  |         |   |                          ***               |  ***        
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                                     ****  ****       |   |        |   |                        | |                               ****                           ****         |   |                                            |    |        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                    |   |        |   |                        | |                                                                           |   |                                            ******        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                    *****        *****                        | |                                                                           *****                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                              ***                                                                                                                                          

chain A : PROGESTERONE RECEPTOR
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084/searchPTHR24084_SF7PFAM:searchPF00104PRINTS:searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP06401
JMol viewer RasMol script viewer  T98 201A  ..                                 *  **     *                                 **     *           *                  *                                                                                            **  *          *                           
JMol viewer RasMol script viewer  SO4 203A  ..                                 |  ||     |           ** **                 ||     |           |                  |                                                                                            ||  |          |                           
sec str:  .....hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee.....
sequence :  ..QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK
seq num:  ..682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |     | |  |  |                       |  | ||| |       |   |        |   ^** | |||   |  |     |      ||   |          | ||  ||       |  | |  |    |  |              |  | |    ^**|   |                          | |                | ||||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |     | |  ^***                       |  | ||| |       |   |        |   |   | |||   |  |     |      ||   |          | |^***|       |  | |  |    ^***              |  | |    |  |   |                          | |                | ||||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  |     | |                             |  | ||| |       |   |        |   |   | |||   |  |     *******^|   |          | ||   |       |  | |  |                      |  | |    |  |   |                          | |                | ||||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |     | |                             |  | ||| |       |   |        |   |   | |||   |  |             |   |          | ||   |       |  | |  |                      |  | ^*****  |   |                          | |                | ||||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |     | |                             |  ****| |       |   |        |   |   ****|   ****             |   |          | ||   |       |  | ****                      |  | |       |   |                          | |                ****||       
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |     ***                             |  | *** |       |   |        |   |   *****                    |   |          ***|   |       |  |                           |  | |       |   |                          ***                  ****       
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                                     ****  ****       |   |        |   |                            |   |             |   |       ****                           ******       |   |                                                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                    |   |        |   |                            |   |             *****                                                   |   |                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                    *****        *****                            *****                                                                     *****                                                          

   New search    1zuc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML