triangle PDBeMotif: 1zqx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.7
Classification nucleotidyltransferase    | release date: Fri, Apr 19, 1996
Title dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soa presence of kcl (150 millimolar)
Authors H.PELLETIER, M.R.SAWAYA
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVK
KLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSENDE
NEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRY
REPKDRSE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA POLYMERASE BETA
member of: CATH:search1.10.150.20/search3.30.210.10/search3.30.460.10GENE3D:searchG3DSA_1.10.150.20/searchG3DSA_1.10.8.310/searchG3DSA_3.30.210.10/searchG3DSA_3.30.460.10PANTHER:searchPTHR11276PFAM:searchPF10391/searchPF14791/searchPF14792PRINTS:searchDNAPOLX/searchDNAPOLXBETAPROSITE PATTERNS:searchPS00522, SMART:searchSM00278/searchSM00483SUPERFAMILY:searchSSF81301/searchSSF81585UniProt:searchP06766
sec str:  ...hhhhhhhhhhh.....hhhhhhhhhhh...hhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....eeeeehhhhhh......eeeeee...........hhhhhhhhhhhhh...eeee......eeeeee......... ......eeeeee...hhhhhhhhhhhh..hhhhhhhhhhhhh..eeee..eeee...............hhhhhhhh......hhh...
sequence :  ..DDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSEN... ..EYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
seq num:  ..91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241  ... ..249       259       269       279       289       299       309       319       329    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||||| || || | || ||| |||||| | |||  || ||           || ||                  |  |  |     || |||| | || |    ||^***||||           || ||||    | || |        |  ..PS00001..                    ||  | |||       |||||||| || | |     | |       | ||  | |||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||||| || || | || ||| |||||| | |||  || ||           || ||                  |  |  |     |^**||| | || |    || || |^**           || ||||    | || |        |  ..PS00005..                    ||  | |||       |||||||| || ^**     | |       | ||  | |||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||||| || || | || ||| |||||| ^***|  || ||           || ||                  |  |  |     |  |||| ^*** |    || || ||||           || ||||    ^*** |        ^**..PS00006..                    ||  ^***|       |||||||^*** |       | |       ^***  | |||          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| ||||| || || | || ||| |||||| | | |  || ||           || ||                  ******^     |  ||||   || |    || || ||||           || ||||      |  |           ..PS00007..                    ||  | | |       |||||||  |  |       | |       | |   | |||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||||| || || ^*****|| |||||| | | |  || ||           || ||                     |  |     |  ||^*****| |    || || ||||           || ||||      |  |           ..PS00008..                    ||  | | |       |||||||  |  |       | |       | |   | |||          
search RasMol script viewer Motif-ligand binding stats  DNA_POLYMERASE_X ..| ||||| || || | ||  || |||||| | | |  || ||           || ||                     |  |     ****^******^*^****** || ||||           || ||||      |  |           ..PS00522..                    ||  | | |       |||||||  |  |       | |       | |   | |||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..******* || || | |*********||| | | |  || ||           || ||                     |  |     |  || |           |  || ||||           || ||||      |  |           ..alphabetamotif..                    ||  | | |       *****||  |  |       | |       | |   | |||          
search RasMol script viewer Motif-ligand binding stats  betaturn ..******  ***** | |***********| | | ********           *****                     |  |     ****| |           ********||           |****||      |  |           ..betaturn..                    |**** | |       ******|  |  |       | |       | |   ****|          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  | ***      |  | | | |     |  |            |  |                     |  |         | |           |  || ||||           |  ||||      |  |           ..gammaturn..                    |   | | |        |  | |  |  |       ***       | |     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |          |  *** | |     |  |            |  |                     |  |         ***           |  || |***           |  ****      |  |           ..nest..                    |   | | |        |  ***  |  |                 | |     ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         ****          |    | | |     ****            ****                     ****                       ****| | |            |    |       ****           ..niche..                    |   | | |        |    |  ****                 | |                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       ****** | |                                                                             | | |            ******                      ..schellmannloop..                    |   | | |        ******                       | |                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                              | |                                                                             *****                                        ..stmotif..                    |   | | |                                     | |                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              | |                                                                             | |                                          ..ststaple..                    ***** | |                                     | |                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                              ***                                                                             ***                                          ..stturn..                          ***                                     ***                  

   New search    1zqx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors