triangle PDBeMotif: 1zik  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification leucine zipper    | release date: Wed, Oct 30, 1996
Title gcn4-leucine zipper core mutant asn16lys in the dimeric state
Authors D.N.WOOLFSON, L.GONZALEZ JUNIOR, T.ALBER
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
RMKQLEDKVEELLSKKYHLENEVARLKKLVGER
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GENERAL CONTROL PROTEIN GCN4
member of: GENE3D:searchG3DSA_1.20.5.1070PANTHER:searchPTHR11462/searchPTHR11462_SF35PFAM:searchPF00170PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF57959UniProt:searchP03069
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..RMKQLEDKVEELLSKKYHLENEVARLKKLV
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |        ^**||       |    
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..    **********************    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             *****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****             

chain B : GENERAL CONTROL PROTEIN GCN4
member of: GENE3D:searchG3DSA_1.20.5.1070PANTHER:searchPTHR11462/searchPTHR11462_SF35PFAM:searchPF00170PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF57959UniProt:searchP03069
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..RMKQLEDKVEELLSKKYHLENEVARLKKLV
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |        ^**         |  ||
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..    **********************  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                         *****
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         **** 

   New search    1zik:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML