triangle PDBeMotif: 1z83  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.4.3
Classification transferase    | release date: Tue, Mar 29, 2005
Title crystal structure of human ak1a in complex with ap5a
Authors A., A.JANSSON, A.SCHREURS, F.VON DELFT, G.BUNKOCZI, M.SUNDSTROM, P.FILIPPAKOPOULOS, S.KNAPP, STRUCTURAL GENOMICS CONSORTIUM (SGC
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search SO4 SO4 binding statistics SO4   search AP5 AP5 binding statistics AP5
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDA
MVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEP
VIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADENYLATE KINASE 1
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300HAMAP:searchMF_00235/searchMF_03171PANTHER:searchPTHR23359/searchPTHR23359_SF59PFAM:searchPF00406PRINTS:searchADENYLTKNASEPROSITE PATTERNS:searchPS00113, SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR01360UniProt:searchP00568
JMol viewer RasMol script viewer  AP5 631A  ..                 *******               **  **                *   ***    *                     ** *   *                          *   *     *          *                           ***               
JMol viewer RasMol script viewer  SO4 703B  ..                 |||||||               ||  ||                |   |||    |         **          || |   |                          |   |     |          |                           |||               
JMol viewer RasMol script viewer  SO4 702A  ..                 |||||||               ||  ||                |   |||    |         ||          || |   |     *                    |   |     |          |                           |||               
JMol viewer RasMol script viewer  ZN 642B  ..                 |||||||               ||  ||                |   |||  * | *       ||          || |   |     |                    |   |     |          |                           |||               
JMol viewer RasMol script viewer  ZN 641A  ..                 |||||||  *         *  ||  ||                |   |||  | | |       ||          || |   |     |                    |   |     |          |                           |||               
JMol viewer RasMol script viewer  ZN 601A  ..                 |||||||  |         |  ||  ||                |   |||  | | |       ||          || |   |     |                    |   |     |          |                           |||               
sec str:  ..hhhhhhhh..eeeeee....hhhhhhhhhhhhhh.eeeehhhhhhhhhh..hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhh..
sequence :  ..SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALL
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |||  |      |  ||||||  |     | |   |  ||      ||| | ||||    | |     |  |         |^***|| |  ||    |                        | |   ||  | | |||  | | |    |            ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |||  |      |  ||||||  |     | |   |  ||      ||| | **^*    | |     |  |         | ||||| |  ||    |                        | |   ||  | | |||  | | |    |            ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |||  |      |  |^**||  |     | |   |  ||      ||^** ||      | |     |  |         | ^**|| |  ||    |                        ^**   ||  ^** |||  ^** |    |            ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***||  |      |  |||||^***     | |   ^***|      ||| | ||      | |     ^***         |  | || |  ||    |                              ||  | | |||    | |    |            ||||   | |||   |     ^***   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ||  |      |  |||||         | |   |   |      ||| | ||      | |                  |  | || |  ||    |                              ||  | | |||    *******^            ||||   | |||   |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||  |      ^*****||         | |   |   |      |^*****|      | |                  |  | || |  ||    |                              ||  | | |||      |                 ||||   | |^*****            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    ||  |         |||||         | |   |   |      | | ^***      | |                  |  | || |  ||    |                              ||  | | |||      |                 ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  ADENYLATE_KINASE ..    ||  |         |||||         | |   |   |      | |   |       | |                  |  | |**^***^*****                              ||  | | |||      |                 ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..    ||  |         *****         ***   |   |      ***   |       ***                  |  | |  |  |                                    ||  | | |||      |                 ****   | | |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..    |****            |                |   |      | |   |                            **** |  ****                                    |****** ***      |                  ***   *** |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..    |   |            |                *****      | *****                               | |                                          |   | | ||       |                            *****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..    *****            |                           | |                                   | |                                          |   | | ||       |                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                     |                           ***                                   ***                                          |   *** ||       |                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                     *                                                                                                              *     * **       *                                             

chain B : ADENYLATE KINASE 1
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300HAMAP:searchMF_00235/searchMF_03171PANTHER:searchPTHR23359/searchPTHR23359_SF59PFAM:searchPF00406PRINTS:searchADENYLTKNASEPROSITE PATTERNS:searchPS00113, SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR01360UniProt:searchP00568
JMol viewer RasMol script viewer  SO4 703B  ..**                                                                                                                                                                                                 
JMol viewer RasMol script viewer  SO4 702A  ..||                                                   *                                                                                                                                             
JMol viewer RasMol script viewer  SO4 701B  ..||                                 *                 |                             *  *                                                                                                            
JMol viewer RasMol script viewer  ZN 643B  ..||                        *        |*                |                             |  |                                                                                                            
JMol viewer RasMol script viewer  ZN 642B  ..||                        |        ||                |                *            |  |                 *                                                                                          
JMol viewer RasMol script viewer  ZN 611B  ..||                        |        ||                |                |            |  |                 |                                                                                          
sec str:  ..hhhhhhh...eeeeee....hhhhhhhhhhhhhh.eeeehhhhhhhhhhh.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhhh
sequence :  ..SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALL
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |||  |      |  ||||||  |     | |   |  |       ||| | ||||    | |     |  |         |^***|| |  ||    |                        | |   ||  | |||||  | |||  | |  |  |   || ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |||  |      |  ||||||  |     | |   |  |       ||| | **^*    | |     |  |         | ||||| |  ||    |                        | |   ||  | |||||  | |||  | |  |  |   || ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |||  |      |  |^**||  |     | |   |  |       ||^** ||      | |     |  |         | ^**|| |  ||    |                        ^**   ||  ^**||||  ^**||  | |  |  |   || ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***||  |      |  |||||^***     | |   ^***       ||| | ||      | |     ^***         |  | || |  ||    |                              ||  | |||||    |||  | |  |  |   || ||||   | |||   |     ^***   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|   ||  |      |  |||||         | |              ||| | ||      | |                  |  | || |  ||    |                              ||  | |||||    *******^  |  |   || ||||   | |||   |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|   ||  |      ^*****||         | |              |^*****|      | |                  |  | || |  ||    |                              ||  | |||||     ||  |    |  |   || ||||   | |^*****            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|   ||  |         |||||         | |              | | ^***      | |                  |  | || |  ||    |                              ||  | |||||     ||  |    |  |   || ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  ADENYLATE_KINASE ..|   ||  |         |||||         | |              | |   |       | |                  |  | |**^***^*****                              ||  | |||||     ||  |    |  |   || ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..|   ||  |         |||||         | |              | |   |       | |                  |  | |  |  |                                    ||  | |||||     ||  |    |  |   || ||||   *** |   |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   ||  |         |||||         | |              | |   |       | |                  |  | |  |  |                                    ||  | |||||     ||  |    ****   *****||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..|   ||  |         *****         ***              ***   |       ***                  |  | |  |  |                                    ||  | |||||     ||  |              ****   | | |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..|   |****            |                           | |   |                            **** |  ****                                    |**********     ||  |               ***   *** |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..*****                |                           | *****                               | |                                          |     | ||      ||  |                         *****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     |                           | |                                   | |                                          |     | ||      *****                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                     |                           ***                                   ***                                          |     | ||       |                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                     *                                                                                                              *     * **       *                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ADENYLATE KINASE 1
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300HAMAP:searchMF_00235/searchMF_03171PANTHER:searchPTHR23359/searchPTHR23359_SF59PFAM:searchPF00406PRINTS:searchADENYLTKNASEPROSITE PATTERNS:searchPS00113, SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR01360UniProt:searchP00568
JMol viewer RasMol script viewer  AP5 632B  ..                 *******               **  **                *   ***                          ** *   *                          **  *     *          *                           ***               
JMol viewer RasMol script viewer  SO4 703B  ..**               |||||||               ||  ||                |   |||                          || |   |                          ||  |     |          |                           |||               
JMol viewer RasMol script viewer  SO4 701B  ..||               |||||||           *   ||  ||                |   |||               *  *       || |   |                          ||  |     |          |                           |||               
JMol viewer RasMol script viewer  ZN 643B  ..||               |||||||  *        |*  ||  ||                |   |||               |  |       || |   |                          ||  |     |          |                           |||               
JMol viewer RasMol script viewer  ZN 611B  ..||               |||||||  |        ||  ||  ||                |   |||               |  |       || |   |                          ||  |     |          |                           |||               
sec str:  ..hhhhhhh...eeeeee....hhhhhhhhhhhhhh.eeeehhhhhhhhhhh.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhhh
sequence :  ..SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALL
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |||  |      |  ||||||  |     | |   |  |       ||| | ||||    | |     |  |         |^***|| |  ||    |                        | |   ||  | |||||  | |||  | |  |  |   || ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |||  |      |  ||||||  |     | |   |  |       ||| | **^*    | |     |  |         | ||||| |  ||    |                        | |   ||  | |||||  | |||  | |  |  |   || ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |||  |      |  |^**||  |     | |   |  |       ||^** ||      | |     |  |         | ^**|| |  ||    |                        ^**   ||  ^**||||  ^**||  | |  |  |   || ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***||  |      |  |||||^***     | |   ^***       ||| | ||      | |     ^***         |  | || |  ||    |                              ||  | |||||    |||  | |  |  |   || ||||   | |||   |     ^***   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|   ||  |      |  |||||         | |              ||| | ||      | |                  |  | || |  ||    |                              ||  | |||||    *******^  |  |   || ||||   | |||   |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|   ||  |      ^*****||         | |              |^*****|      | |                  |  | || |  ||    |                              ||  | |||||     ||  |    |  |   || ||||   | |^*****            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|   ||  |         |||||         | |              | | ^***      | |                  |  | || |  ||    |                              ||  | |||||     ||  |    |  |   || ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  ADENYLATE_KINASE ..|   ||  |         |||||         | |              | |   |       | |                  |  | |**^***^*****                              ||  | |||||     ||  |    |  |   || ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..|   ||  |         |||||         | |              | |   |       | |                  |  | |  |  |                                    ||  | |||||     ||  |    |  |   || ||||   *** |   |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   ||  |         |||||         | |              | |   |       | |                  |  | |  |  |                                    ||  | |||||     ||  |    ****   *****||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..|   ||  |         *****         ***              ***   |       ***                  |  | |  |  |                                    ||  | |||||     ||  |              ****   | | |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..|   |****            |                           | |   |                            **** |  ****                                    |**********     ||  |               ***   *** |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..*****                |                           | *****                               | |                                          |     | ||      ||  |                         *****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     |                           | |                                   | |                                          |     | ||      *****                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                     |                           ***                                   ***                                          |     | ||       |                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                     *                                                                                                              *     * **       *                                             

chain C : ADENYLATE KINASE 1
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300HAMAP:searchMF_00235/searchMF_03171PANTHER:searchPTHR23359/searchPTHR23359_SF59PFAM:searchPF00406PRINTS:searchADENYLTKNASEPROSITE PATTERNS:searchPS00113, SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR01360UniProt:searchP00568
JMol viewer RasMol script viewer  AP5 633C  ..                 *******               **  **                *   ***                          ** *   *                          *   *     *          *                           *                 
JMol viewer RasMol script viewer  ZN 645C  ..                 |||||||               ||  ||                |   |||  *   *                   || |   |                          |   |     |          |                           |                 
JMol viewer RasMol script viewer  ZN 644C  ..                 |||||||  *         *  ||  ||                |   |||  |   |                   || |   |                          |   |     |          |                           |                 
JMol viewer RasMol script viewer  ZN 621C  ..                 |||||||  |         |  ||  ||                |   |||  |   |                   || |   |                          |   |     |          |                           |                 
sec str:  ..hhhhhhh...eeeeee....hhhhhhhhhhhhhh.eeeehhhhhhhhhhh.hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhhh
sequence :  ..SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALL
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |  |      |  ||||||  |     | |   |  ||      ||| | ||||    | |     |  |         |^***|| |  ||    |                        | |   |   | |||||  | |||  | |  |  |    | ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  | |  |      |  ||||||  |     | |   |  ||      ||| | **^*    | |     |  |         | ||||| |  ||    |                        | |   |   | |||||  | |||  | |  |  |    | ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |  |      |  |^**||  |     | |   |  ||      ||^** ||      | |     |  |         | ^**|| |  ||    |                        ^**   |   ^**||||  ^**||  | |  |  |    | ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^*** |  |      |  |||||^***     | |   ^***|      ||| | ||      | |     ^***         |  | || |  ||    |                              |   | |||||    |||  | |  |  |    | ||||   | |||   |     ^***   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |      |  |||||         | |   |   |      ||| | ||      | |                  |  | || |  ||    |                              |   | |||||    *******^  |  |    | ||||   | |||   |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |      ^*****||         | |   |   |      |^*****|      | |                  |  | || |  ||    |                              |   | |||||     ||  |    |  |    | ||||   | |^*****            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..     |  |         |||||         | |   |   |      | | ^***      | |                  |  | || |  ||    |                              |   | |||||     ||  |    |  |    | ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  ADENYLATE_KINASE ..     |  |         |||||         | |   |   |      | |           | |                  |  | |**^***^*****                              |   | |||||     ||  |    |  |    | ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |         |||||         | |   |   |      | |           | |                  |  | |  |  |                                    |   | |||||     ||  |    |  |    | ||||   *** |   |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |         |||||         | |   |   |      | |           | |                  |  | |  |  |                                    |   | |||||     ||  |    ****    ****||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         *****         ***   |   |      ***           ***                  |  | |  |  |                                    |   | |||||     ||  |              ****   | | |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..     ****            |                |   |      | |                                **** |  ****                                    |   | |****     ||  |               ***   *** |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     |                *****      | |                                   | |                                          |   | | ||      ||  |                         *****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     |                           | |                                   | |                                          ***** | ||      *****                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                     |                           ***                                   ***                                          |     | ||       |                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                     *                                                                                                              *     * **       *                                             

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : ADENYLATE KINASE 1
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300HAMAP:searchMF_00235/searchMF_03171PANTHER:searchPTHR23359/searchPTHR23359_SF59PFAM:searchPF00406PRINTS:searchADENYLTKNASEPROSITE PATTERNS:searchPS00113, SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR01360UniProt:searchP00568
JMol viewer RasMol script viewer  AP5 633C  ..                 *******               **  **                *   ***                          ** *   *                          *   *     *          *                           *                 
JMol viewer RasMol script viewer  ZN 645C  ..                 |||||||               ||  ||                |   |||  *   *                   || |   |                          |   |     |          |                           |                 
JMol viewer RasMol script viewer  ZN 644C  ..                 |||||||  *         *  ||  ||                |   |||  |   |                   || |   |                          |   |     |          |                           |                 
JMol viewer RasMol script viewer  ZN 621C  ..                 |||||||  |         |  ||  ||                |   |||  |   |                   || |   |                          |   |     |          |                           |                 
sec str:  ..hhhhhhh...eeeeee....hhhhhhhhhhhhhh.eeeehhhhhhhhhhh.hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhhh
sequence :  ..SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALL
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |  |      |  ||||||  |     | |   |  ||      ||| | ||||    | |     |  |         |^***|| |  ||    |                        | |   |   | |||||  | |||  | |  |  |    | ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  | |  |      |  ||||||  |     | |   |  ||      ||| | **^*    | |     |  |         | ||||| |  ||    |                        | |   |   | |||||  | |||  | |  |  |    | ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |  |      |  |^**||  |     | |   |  ||      ||^** ||      | |     |  |         | ^**|| |  ||    |                        ^**   |   ^**||||  ^**||  | |  |  |    | ||||   | |||   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^*** |  |      |  |||||^***     | |   ^***|      ||| | ||      | |     ^***         |  | || |  ||    |                              |   | |||||    |||  | |  |  |    | ||||   | |||   |     ^***   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |      |  |||||         | |   |   |      ||| | ||      | |                  |  | || |  ||    |                              |   | |||||    *******^  |  |    | ||||   | |||   |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |      ^*****||         | |   |   |      |^*****|      | |                  |  | || |  ||    |                              |   | |||||     ||  |    |  |    | ||||   | |^*****            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..     |  |         |||||         | |   |   |      | | ^***      | |                  |  | || |  ||    |                              |   | |||||     ||  |    |  |    | ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  ADENYLATE_KINASE ..     |  |         |||||         | |   |   |      | |           | |                  |  | |**^***^*****                              |   | |||||     ||  |    |  |    | ||||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |         |||||         | |   |   |      | |           | |                  |  | |  |  |                                    |   | |||||     ||  |    |  |    | ||||   *** |   |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |         |||||         | |   |   |      | |           | |                  |  | |  |  |                                    |   | |||||     ||  |    ****    ****||   | | |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |         *****         ***   |   |      ***           ***                  |  | |  |  |                                    |   | |||||     ||  |              ****   | | |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..     ****            |                |   |      | |                                **** |  ****                                    |   | |****     ||  |               ***   *** |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     |                *****      | |                                   | |                                          |   | | ||      ||  |                         *****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     |                           | |                                   | |                                          ***** | ||      *****                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                     |                           ***                                   ***                                          |     | ||       |                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                     *                                                                                                              *     * **       *                                             

   New search    1z83:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors