triangle PDBeMotif: 1z0f  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein transport    | release date: Tue, Mar 1, 2005
Title gdp-bound rab14 gtpase
Authors C.RITACCO, D.G.LAMBRIGHT, S.EATHIRAJ, X.PAN
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GDP GDP binding statistics GDP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLGSATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAV
TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAK
TGENVEDAFLEAAKKIYQN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RAB14, MEMBER RAS ONCOGENE FAMILY
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF185PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchP61106
JMol viewer RasMol script viewer  GDP 200A  ..              ******         *                                                                                       ** **                         ***                 
JMol viewer RasMol script viewer  MG 201A  ..              ||||*|         |                             *                                                         || ||                         |||                 
sec str:  .....eeeeeeee.....hhhhhhhhhhhh.............eeeeeeee..eeeeeeeee..hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhh
sequence :  ..NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIY
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***       |  |||||| |   |||| ||||  | |    |    |  |        | | |  |      | ||   |   | |||||            ^*** ||       | | |  |  |  |       | |     | || || |           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |  |||||| |   |||| ||||  | |    |    |  |        | | |  |      | ||   |   | |**^*               | ||       | | |  |  |  |       | |     | || || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  |||||| |   ^**| ||||  | |    |    |  |        | | |  |      | ||   |   | ^**                 | ||       | | |  |  |  |       | |     ^**| || |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |||||| |   || | ||||  | |    |    |  |        | | |  |      | ||   |   |  |                  | ||       | | |  |  ^***       | |        | || |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  ^***** |   || | ||||  | ^*****    |  |        | | |  |      | ^*****   |  |                  | ||       | | |  |             | |        | || |           
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..           ********  |   || | ||||  |           |  |        | | |  |      |  |       |  |                  | ||       | | |  |             | |        | || |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |||||  |   || | ||||  |           |  |        | | |  |      |  |       |  |                  ***|       | | |  |             | |        | || |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |||||  |   || | ||||  |           ****        | | |  |      |  |       ****                  |  |       | | |  |             | |        | || |           
search RasMol script viewer Motif-ligand binding stats  nest ..              *****  |   |*** ****  |                       *****  |      |  |       |  |                  |  |       *** |  |             ***        ******           
search RasMol script viewer Motif-ligand binding stats  niche ..                     |   |       ****                           ****      ****       ****                  ****           ****                        | |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****                                                                                                                            | |              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                      ***              

   New search    1z0f:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors