triangle PDBeMotif: 1yxj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lipid binding protein    | release date: Tue, Feb 22, 2005
Title crystal structure of human lectin-like oxidized low-density lipoprotein receptor 1 (lox-1) at low ph
Authors D.TSUCHIYA, I.OHKI, K.MORIKAWA, M.OHNISHIKAMEYAMA, Q.XIE, S.MACHIDA, S.MATSUNAGA, S.TATE, T.ISHIGAKI, T.MURATA, T.OYAMA
Method X-RAY DIFFRACTION (resolution: 1.78Å)
PDBe Citation   
Small molecules:    search EDO EDO binding statistics EDO
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGS
PLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OXIDISED LOW DENSITY LIPOPROTEIN (LECTIN-LIKE)RECEPTOR 1;
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_3.10.100.10PANTHER:searchPTHR22800/searchPTHR22800_SF146PFAM:searchPF00059PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchP78380
JMol viewer RasMol script viewer  EDO 2001B  ..        * *                                                                                                                       
JMol viewer RasMol script viewer  EDO 2002A  ..        **|                                     *                                                                                 
sec str:  .........eee..eeeee.....hhhhhhhhhhh...ee....hhhhhhhhhhhhh.....eeeeeee.......ee............eee.........eeeeee..eeeeee.....eeeeeee....
sequence :  ..MPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLR
seq num:  ..142       152       162       172       182       192       202       212       222       232       242       252       262       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |  |  |                 |  | |     ^***||       | | |   | || ||  |   | |||    | |    |  | |  |       |    ||  |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |  |  |                 |  | |      |  ||       | | |   | |^**|  |   | |||    | |    |  | |  |       |    ||  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |  |  |                 |  | |      ^***|       | | |   | |   |  |   | |||    | |    |  | |  |       |    ||  |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |  |  |                 |  | |      |   |       | | |   | |   |  |   | |||    | |    |  | |  |       ^*****|  |             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   |  |  |  |                 |  | |      |   |       | | |   | |   |  |   *****    | |    |  | |  |             |  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****  ****                 **** |      |   |       | | |   | |   |  |   ****|    | |    |  | ****             |  |             
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                          ***      |   |       | | |   | |   |  |     ***    ***    |  |                  |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                   |   |       *****   ***   ****                   ****                  ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                          *****         | |                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                        ***                                                                       

chain B : OXIDISED LOW DENSITY LIPOPROTEIN (LECTIN-LIKE)RECEPTOR 1;
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_3.10.100.10PANTHER:searchPTHR22800/searchPTHR22800_SF146PFAM:searchPF00059PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchP78380
JMol viewer RasMol script viewer  EDO 2001B  ..       **                                      *                                                                                
JMol viewer RasMol script viewer  EDO 2002A  ..       *|                                      |                                                                                
sec str:  ........eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhh......eeeeeee.....................eee.........eeeeee..eeeeee.....eeeeeee...
sequence :  ..PCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANL
seq num:  ..143       153       163       173       183       193       203       213       223       233       243       253       263     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |          | |             | |     ^***|       |  | |   | || || ||   | |||    | |    |  | |  |       |    ||  |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |          | |             | |      |  |       |  | |   | |^**| ||   | |||    | |    |  | |  |       |    ||  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |          | |             | |      ^***       |  | |   | |   | ||   | |||    | |    |  | |  |       |    ||  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |          | |             | |                 |  | |   | |   | ||   | |||    | |    |  | |  |       ^*****|  |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |          | |             | |                 |  | |   | |   ***|   | |||    | |    |  | |  |             |  |            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |          | |             | |                 |  | |   | |   |  |   *****    | |    |  | |  |             |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****          | |             | |                 |  | |   | |   |  |   ****|    | |    |  | ****             |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |          | |             ***                 |  | |   | |   |  |     ***    ***    |  |                  |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ****          ***                                 ******   ***   ****                   ****                  ****            

   New search    1yxj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors