triangle PDBeMotif: 1yok  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Thu, Jan 27, 2005
Title crystal structure of human lrh-1 bound with tif-2 peptide and phosphatidylglycerol
Authors D.JUZUMIENE, E.P.SABLIN, G.M.WAITT, H.A.INGRAHAM, I.N.KRYLOVA, J.A.MACKAY, J.D.WILLIAMS, J.M.BYNUM, J.MOORE, J.W.THORNTON, K.MADAUSS, L.LEBEDEVA, M.SUZAWA, R.J.FLETTERICK, R.K.GUY, R.X.XU, S.P.WILLIAMS, T.M.WILLSON, V.MONTANA
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search P6L P6L binding statistics P6L
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MKKHHHHHHLVPRGSIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIF
FRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQ
REFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGD
VPYNNLLIEMLHAKRA
Chains B,C sequence:
KENALLRYLLDKDD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ORPHAN NUCLEAR RECEPTOR NR5A2
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24086/searchPTHR24086_SF18PFAM:searchPF00104PIRSF:searchPIRSF002530PRINTS:searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchO00482
JMol viewer RasMol script viewer  P6L 100A  ..                                   ..   **  *                                         *  *                         *  * * **  *                                                                                     *  *  **           *      
sec str:  ....hhhhhhhhh...hhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eee.....eeehhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhh.
sequence :  ..SIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRS..KLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHA
seq num:  ..300       310       320       330  ..338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       ||||||                   ^**..  |   |   |   |  |  |       |  |                         |  |        | |           |    |            | ||||   |         | ||  |                            | |          |   |            ||||       |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       ||||||                     |..  |   |   |   |  |  |       |  |                         |  |        | |           |    |            | ||||   |         | ||  |                            ^**          |   |            ||||       |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ||||||                     ^..  |   |   |   |  ^***       |  |                         |  |        | |           |    |            | ||||   |         | ||  |                                         |   |            ||||       |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ||||||                      ..  |   |   |   |             |  |                         |  |        | |           ^*****            | ||||   |         | ||  |                                         |   |            ||||       |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       ||||||                      ..  |   |   |   |             |  |                         |  |        | |                             | |||*****         | ||  |                                         |   |            ||||       |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       *****|                      ..  |   |   |   |             |  |                         |  |        | |                             ****|              | ||  |                                         |   |            ||||       |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                      ..  |   |   |   |             |  |                         |  |        ***                               ***              | ||  |                                         |   |            ****       |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                      ..  |   |   |   |             ****                         ****                                                           *******                                         |   |             ***       **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                   ..  *****   |   |                                                                                                         | |                                             |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                   ..          *****                                                                                                         | |                                             *****                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                   ..                                                                                                                        ***                                                                              

chain B : NUCLEAR RECEPTOR COACTIVATOR 2
member of: PANTHER:searchPTHR10684/searchPTHR10684_SF2PIRSF:searchPIRSF038181UniProt:searchQ15596
sec str:  ..hhhhhhhhhh.
sequence :  ..NALLRYLLDKD
seq num:  ..742        
search RasMol script viewer Motif-ligand binding stats  niche ..      **** 

chain C : NUCLEAR RECEPTOR COACTIVATOR 2
member of: PANTHER:searchPTHR10684/searchPTHR10684_SF2PIRSF:searchPIRSF038181UniProt:searchQ15596
sec str:  ....hhhhhhhhhh..
sequence :  ..KENALLRYLLDKDD
seq num:  ..740       750 
search RasMol script viewer Motif-ligand binding stats  niche ..        ****  

   New search    1yok:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors