triangle PDBeMotif: 1xwd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hormone/growth factor    | release date: Sat, Oct 30, 2004
Title crystal structure of human follicle stimulating hormone comp its receptor
Authors Q.R.FAN, W.A.HENDRICKSON
Method X-RAY DIFFRACTION (resolution: 2.92Å)
PDBe Citation   
Small molecules:    search BMA BMA binding statistics BMA   search NAG NAG binding statistics NAG   search SO4 SO4 binding statistics SO4
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,D sequence:
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHT
ACHCSTCYYHKS
Chains B,E sequence:
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Chains C,F sequence:
GCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPK
LHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILW
LNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLP
TLEKLVALMEAS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GLYCOPROTEIN HORMONES ALPHA CHAIN
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11509/searchPTHR11509_SF0PFAM:searchPF00236PRINTS:searchGLYCOHORMONEPROSITE PATTERNS:searchPS00779/searchPS00780, PROSITE PROFILES:searchPS50277, SMART:searchSM00067SUPERFAMILY:searchSSF57501UniProt:searchP01215
JMol viewer RasMol script viewer  SO4 403B  ..                        *                                                                 
JMol viewer RasMol script viewer  SO4 402B  ..                        |       *                                                         
JMol viewer RasMol script viewer  NAG 94A  ..                     ** |       |                                *         * *            
JMol viewer RasMol script viewer  NAG 93A  ..                     || |       |                *               |         | |            
sec str:  ..........eeee...........eeeeeeeeeeeee.hhhhhh.......eeeee.eeeeeeeeeeee...eeeeeeeeeeee.......
sequence :  ..DVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
seq num:  ..3         13        23        33        43        53        63        73        83        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  | |  |        | |||  |    |  |||||    ^***                | |   ^***| |  | | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  | |  |        | |||  |    |  ^**||                        | |   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^*** |  |        | |||  |    |  || ||                        | |   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |        | ^*****    |  || ||                        | |   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_ALPHA_1 ..             |  |        ^**^^********  || ||                        | |   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_ALPHA_2 ..             |  |                    |  || ||                        | |   ****^*^**^**** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             |  |                    ***** ||                        | |              | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |                    *******|                        | |              | | 
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |                        |  |                        ***              | | 
search RasMol script viewer Motif-ligand binding stats  niche ..             ****                        ****                                         *** 

chain B : FOLLITROPIN BETA CHAIN
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11515/searchPTHR11515_SF6PFAM:searchPF00007PROSITE PATTERNS:searchPS00261/searchPS00689, SMART:searchSM00068SUPERFAMILY:searchSSF57501UniProt:searchP01225
JMol viewer RasMol script viewer  SO4 401C  ..                                                                                              *          
JMol viewer RasMol script viewer  SO4 403B  ..                                * *      *                                                    |          
JMol viewer RasMol script viewer  SO4 402B  ..                                | |      |                                                    |  ***     
JMol viewer RasMol script viewer  NAG 113B  ..                     *          | |      |                                                    |  |||     
JMol viewer RasMol script viewer  NAG 112B  ..    *                |          | |      |                                                    |  |||     
JMol viewer RasMol script viewer  NAG 93A  ..    |                |          | |      |             *                                      |  |||     
sec str:  ...eeeeeeeeeee....eeeeeeeeeeeeeeeee..............eeeeeeeeeeeeee........eeeeeeeeeeeeee......eeee............
sequence :  ..CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFG
seq num:  ..3         13        23        33        43        53        63        73        83        93        103  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    ^***      | |    ^***|   | |      |  |       | ||    | |              |    | |  | |  | || || |  |||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              | |        |   | |      |  |       ^**|    ^**              |    | |  | |  | |^**| |  |||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              | |        |   | |      |  |       ^***                     |    | |  | |  | |   | |  ||^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | |        |   | |      |  |                                |    | |  | |  | |   ^*****|   
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_BETA_1 ..              | |        ^***^**      |  |                                |    | |  | |  | |     |  ||   
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_BETA_2 ..              | |                     |  |                                *****^*^**^******^*********^   
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |                     ****                                            |  |       |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..              ***                                                                     |  |       |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                      ****       ****    

chain C : FOLLICLE STIMULATING HORMONE RECEPTOR
member of: CATH:search3.80.10.10GENE3D:searchG3DSA_3.80.10.10PANTHER:searchPTHR24372/searchPTHR24372_SF5PFAM:searchPF01462/searchPF13855PRINTS:searchFSHRECEPTORSMART:searchSM00013SUPERFAMILY:searchSSF52058UniProt:searchP23945
JMol viewer RasMol script viewer  SO4 401C  ..                                  *                                                                                                                                                                                                               
JMol viewer RasMol script viewer  NAG 269C  ..                                  |                                                                                                              *                        *  **                                                                   
sec str:  .......eee...eeeee................eeeee.....ee............eeeee......ee....ee......eeeee......ee....ee......eeeee..................eeeeee......ee............eeee.......ee.........eeeee......................eee..................eee...ee.........
sequence :  ..CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLE
seq num:  ..18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | |            |  |           | |     | || |  |    || || |     | |  |  |       |  |   | |||  |  |       | |     |  | | |        |  |     | ||| | |    | | | |   | |||^*** |  ^***|  |     | || |      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        ^**            |  |           | |     | || |  |    || || |     | |  |  |       |  |   | |||  |  |       | |     |  | | |        |  |     | ||| | |    | | | |   | |||| |  |  | | |  |     | || |      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |            |  |           | |     | || |  |    |^*** |     | |  |  |       |  |   | |||  |  |       | |     |  | | |        |  |     | ||| | |    | | | |   | |||| ^***  | | |  |     | || |      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |            |  |           | |     ^*****  |    |  |  |     | |  |  |       |  |   | |||  |  |       | |     |  | | |        |  |     | ||| | |    | | | |   | |||| |     | | |  |     | || |      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |            |  |           | |     | || |  |    |  |  |     | |  |  |       |  |   *****  |  |       | |     |  | | |        |  |     | ||| | |    | | | |   | |||| |     | | |  |     | || |      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |            |  |           | |     | || |  |    |  |  |     | |  |  |       |  |   ***||  |  |       | |     |  | | |        |  |     | ||| | |    | | | |   | |||| |     *** |  |     | || |      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |            |  |           | |     | || |  |    |  |  |     | |  |  |       |  |   ****|  |  |       | |     **** | |        |  |     | ||| | |    | | | |   ********     | | ****     | ****      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***            |  |           | |     | || |  |    |  |  |     | |  |  |       |  |     | |  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || |     | | |  |     | || |      | | | |      ||| |         |  |     
search RasMol script viewer Motif-ligand binding stats  nest ..                       |  |           | |     ***| |  |    |  |  |     ***  |  |       |  |     | |  |  |       | |        *** |        |  |     ***|*** |    | | | |     ***| |     | | |  |     | || |      | | | |      *** |         |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****           ***     **** ****    *******          ****       ****     ***  ****       ***          | |        ****     ****  | |    *** ***     ******     *** ****     ******      *** ***       ****         ****     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                             ***                       ***                                                                                        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : GLYCOPROTEIN HORMONES ALPHA CHAIN
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11509/searchPTHR11509_SF0PFAM:searchPF00236PRINTS:searchGLYCOHORMONEPROSITE PATTERNS:searchPS00779/searchPS00780, PROSITE PROFILES:searchPS50277, SMART:searchSM00067SUPERFAMILY:searchSSF57501UniProt:searchP01215
JMol viewer RasMol script viewer  NAG 93D  ..                 ****                                         *         *              
sec str:  .......eeee...........eeeeeeeeeeeee...hhhhh......eeeee.eeeeeeeeeee.....eeeeeeeeeee.......
sequence :  ..DCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
seq num:  ..6         16        26        36        46        56        66        76        86     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |||  |        | |||  |    |  ||||| | |^***              | |||   ^***| |  | | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |||  |        | |||  |    |  ^**|| | | |                | |||   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***||  |        | |||  |    |  || || | | |                | |||   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         ||  |        | ^*****    |  || || | | |                | |||   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_ALPHA_1 ..         ||  |        ^**^^********  || || | | |                | |||   |   | |  | | | 
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_ALPHA_2 ..         ||  |                       || || | | |                | |||   ****^*^**^**** 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         ||  |                       || || | | |                *****              | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ||  |                       ****| | | |                ****|              | | 
search RasMol script viewer Motif-ligand binding stats  nest ..         ||  |                        |  | | | |                  ***              | | 
search RasMol script viewer Motif-ligand binding stats  niche ..         |****                        ****** ***                                   *** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..         *****                                                                         

chain E : FOLLITROPIN BETA CHAIN
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11515/searchPTHR11515_SF6PFAM:searchPF00007PROSITE PATTERNS:searchPS00261/searchPS00689, SMART:searchSM00068SUPERFAMILY:searchSSF57501UniProt:searchP01225
JMol viewer RasMol script viewer  NAG 112E  ..    *                                                                                                    
sec str:  ...eeeeeeeeee.hhhh.eeeeeeeeeeeeeeee..............eeeeeeeeeeeeee........eeeeeeeeeeeeee......eeee............
sequence :  ..CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFG
seq num:  ..3         13        23        33        43        53        63        73        83        93        103  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    ^***   |  | |    ^***|   | |      |  |       | ||    | |              |    | |  | |  | || ||    |||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  | |        |   | |      |  |       ^**|    ^**              |    | |  | |  | |^**|    |||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  | |        |   | |      |  |       ^***                     |    | |  | |  | |   |    ||^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  | |        |   | |      |  |                                |    | |  | |  | |   ^*****|   
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_BETA_1 ..           |  | |        ^***^**      |  |                                |    | |  | |  | |         |   
search RasMol script viewer Motif-ligand binding stats  GLYCO_HORMONE_BETA_2 ..           |  | |                     |  |                                *****^*^**^******^*********^   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           **** |                     ****                                            |  |               
search RasMol script viewer Motif-ligand binding stats  nest ..              ***                     |  |                                            |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                                            ****               

chain F : FOLLICLE STIMULATING HORMONE RECEPTOR
member of: CATH:search3.80.10.10GENE3D:searchG3DSA_3.80.10.10PANTHER:searchPTHR24372/searchPTHR24372_SF5PFAM:searchPF01462/searchPF13855PRINTS:searchFSHRECEPTORSMART:searchSM00013SUPERFAMILY:searchSSF52058UniProt:searchP23945
JMol viewer RasMol script viewer  NAG 269F  ..                                                                                                                                                 *                        *  *                                                           
sec str:  ........ee...eeeee................eeeee.....ee............eeeee......ee....ee......eeeeeee....ee....ee......eeeeeee................eeeeee......ee...........eeeee.......ee........eeeeee......................eee..................eee.....
sequence :  ..CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTY
seq num:  ..18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |  | |      | |   |  ||  |       | |     | ||||| |     | || |     | |  |  |       |  |   |||||  |  |       | |        | | |        |  |     | ||| | |    | | | |     | |^*** |  ^***|  |     | || |      | | | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |  ^**      | |   |  ||  |       | |     | ||||| |     | || |     | |  |  |       |  |   |||||  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || |  |  | | |  |     | || |      | | | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |  | |      | |   |  ||  |       | |     | ||||| |     ^*** |     | |  |  |       |  |   |||||  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || ^***  | | |  |     | || |      | | | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |  | |      | |   |  ||  |       | |     ^*****| |       |  |     | |  |  |       |  |   |||||  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || |     | | |  |     | || |      | | | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |  | |      | |   |  ||  |       | |     | ||||| |       |  |     | |  |  |       |  |   *****  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || |     | | |  |     | || |      | | | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |  | |      | |   |  ||  |       | |     | ||||| |       |  |     | |  |  |       |  |   ***||  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || |     *** |  |     | || |      *** | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |  | |      | |   |  ||  |       | |     | ||||| |       |  |     | |  |  |       ****   ****|  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || |     | | |  |     | || |      | | | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |  ***      | |   |  ||  |       | |     | ||*** |       |  |     | |  |  |       |  |    |  |  |  |       | |        | | |        |  |     | ||| | |    | | | |     | || |     | | |  |     | || |      | | | |   | |||| |      | |
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |           | |   |  ||  |       | |     ***| |  |       |  |     ***  |  |       |  |    |  |  |  |       | |        *** |        |  |     ***|*** |    | | | |     ***| |     | | |  |     | || |      | | | |   | |*** |      ***
search RasMol script viewer Motif-ligand binding stats  niche ..  ****           ***   ********       ***     **** ****       ****          ****       ****    ****  ****       ***          | |        ****     ****  | |    *** ***     ******     *** ****     ******      *** ***   *** ****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                             ***                       ***                                                                               

   New search    1xwd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors