triangle PDBeMotif: 1xuf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.4
Classification serine protease    | release date: Fri, Oct 10, 1997
Title trypsin-babim-zn+2, ph 8.2
Authors B.A.KATZ, C.LUONG, C.R.JOHNSON, J.M.CLARK, J.S.FINER-MOORE, M, R.M.STROUD, T.E.JENKINS, W.R.MOORE
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search BAZ BAZ binding statistics BAZ   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRYPSIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24264PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00760
JMol viewer RasMol script viewer  BAZ 246A  ..                       **              *                                                                                                                                  ****  *             **   *       *                   
JMol viewer RasMol script viewer  CA 247A  ..                       ||              |           * *  *    *                                                                                                            ||||  |             ||   |       |                   
sec str:  ................eeeee...eeeeeeeee..eeee.hhh.....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee...hhhhhhh........eeee................eeee..eeeeeeee..........eeeeehhh.hhhhhhhh...
sequence :  ..IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
seq num:  ..16        26        38        48        58        69        79        89        99        109       119       130       141       151       161       171       181       189       199       213       223       233          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |    | |||  |           |   ||||||| |||||  |       | || ||||          |  || ||||| |           | ||                     || | |  | |||           |^**||| | || |||   |  | |||||||| |  ||^**       | |  |         |  |  || ||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    | |||  |           |   ||||||| |||||  |       | || ||||          |  || ||||| |           | ||                     || | |  ^***|           | ||||| | || |||   |  | |||||||| |  ||  |       | |  |         |  |  || ||||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** |||  |           ^*****||||| |||||  |       | || ||||          |  || ||||| |           | ||                     ^*****    | |           | ||||| ^*****||   |  ^*****|||| |  ||  |       ^*****         |  |  || ||||  
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..       | |||  |               | |||****^*||  |       | || ||||          |  || ||||| |           | ||                      | |      | |           | ||||| | || |||   |  | |||||||| |  ||  |         |  |         |  |  || ||||  
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..       | |||  |               | ||| | |  ||  |       | || ||||          |  || ||||| |           | ||                      | |      | |           | ||||| | || |||   |  | |******^*****|  |         |  |         |  |  || ||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||  |               | ||| | |  ||  |       | || ||||          |  || ||||| |           | ||                      | |      | |           | ***** | || |||   |  | |||||||| |   |  |         |  |         |  |  |*****|  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |||  |               ***** | |  ||  |       | || ||||          |  || ||||| |           | ||                      | |      | |           | ||||| | || |||   |  | |||||||| |   |  |         |  |         |  |  || || |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||  |               ***|  | |  ||  |       ***| ||||          |  |***|||| |           ***|                      | |      | |           | ||||| | || |||   |  | |||||||| |   |  |         |  |         |  |  || || |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ********               ****  | |  ||  |       |  | ||||          |  |   |||| |           |  |                      | |      | |           | ***** | |****|   **** ||||||****   ****         |  |         ****  *******  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |  |               |  |  | |  ||  |       |  | ||||          |  |   |||***           |  |                      | |      | |           |   |   | || |||        |||||||| |                |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |               |  |  | |  ||  |       |  | ****          |  |   ***              |  |                      | |      | |           |   |   ***| |||        |||||*** |                |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..           ****               ****  | ********       ****  ***          ****    |               ****                      ***      ***           |   |   *******|        |||||*****                ****                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                    |                                           |                                                                |   |      *****        ||||||                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                    |                                           |                                                                *****      | |          ||||||                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                    |                                           |                                                                           ***          ||||||                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                    *                                           *                                                                                        ******                                                

   New search    1xuf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors