triangle PDBeMotif: 1xtr  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Sun, Oct 24, 2004
Title structure of small gtpase human rheb in complex with gppnhp
Authors J.DING, Y.YU
Method X-RAY DIFFRACTION (resolution: 2.65Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GNP GNP binding statistics GNP   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEKLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GTP-BINDING PROTEIN RHEB
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24070/searchPTHR24070_SF204PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51421, SMART:searchSM00173SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchQ15382
JMol viewer RasMol script viewer  GOL 180A  ..                                                            ***    * *                                                                                                    
JMol viewer RasMol script viewer  GNP 179A  ..             *******         *** *  *                       |*|    | |                                               ** **                         ***                    
JMol viewer RasMol script viewer  MG 178A  ..             |||||*|         ||| |  *                       |||    | |                                               || ||                         |||                    
sec str:  ....eeeeeeeee.....hhhhhhhhhhh...........eeeeeeeeee..eeeeeeeeee.........hhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeee...hhhhh..hhhhhhhhhhhh..eeeee...hhhhhhhhhhhhhhhhhhhh
sequence :  ..PQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKLE
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |    |  |||||  |    | |  | |                                     | || |       |  | |   |  ||     |  | | |       | | |  | ||  |    || |||     | ||^*** |        |  ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ^**    |  |||||  |    | |  | |                                     | || |       |  ^**   |  ||     |  | | |       | | |  | ||  |    || |||     ^**|| |  |        |  ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |||||  |    | |  | |                                     | || |       |  |     |  ||     |  | | |       | | |  | |^***    || |||     ^***| ^***        |  ||
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..           ********  |    | |  | |                                     | || |       |  |     |  ||     |  | | |       | | |  | |        || |||     | |||             |  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              |||||  |    | |  | |                                     | || |       |  |     *****     |  | | |       | | |  | |        || |||     | |||             *****
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |||||  |    | |  | |                                     | || |       |  |     ****      **** | |       | | |  | |        |****|     ****|             **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |||||  |    | |  ***                                     | || |       |  |                    ***       | | |  | |        |  | |     | | |                  
search RasMol script viewer Motif-ligand binding stats  nest ..              *****  |    ***                                          | || |       |  |                              *** |  | |        |  ***     | | |                  
search RasMol script viewer Motif-ligand binding stats  niche ..                 |   |                                                 ******       ****                                  ******        |    |     | | |                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                                                  ******     | | |                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 |   |                                                                                                                             *****                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                                                             | |                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                   ***                    

   New search    1xtr:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors