triangle PDBeMotif: 1xtq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Sun, Oct 24, 2004
Title structure of small gtpase human rheb in complex with gdp
Authors J.DING, Y.YU
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GDP GDP binding statistics GDP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEKLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GTP-BINDING PROTEIN RHEB
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24070/searchPTHR24070_SF204PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51421, SMART:searchSM00173SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchQ15382
JMol viewer RasMol script viewer  GDP 201A  ..             ******         *                                                                                       ** **                         ***                    
JMol viewer RasMol script viewer  MG 202A  ..             ||||*|         |                                                                                       || ||                         |||                    
sec str:  ....eeeeeeeee....hhhhhhhhhhhh...........eeeeeeeee..eeeeeeeee..........hhhhh....eeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeee...hhhhh..hhhhhhhhhhhhh.eeee....hhhhhhhhhhhhhhhhhhhh
sequence :  ..QSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKLE
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |    |  |||||       | |     |  |                         | ||   || || |       |  | | |                | |       | | |  |  |  |       | |     | ||^*** |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**    |  |||||       | |     |  |                         | ||   || || |       |  ^** |                | |       | | |  |  |  |       | |     ^**|| |  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |||||       | |     |  |                         | ||   || || |       |  |   |                | |       | | |  |  ^***       | |     ^***| ^***             
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..          ********       | |     |  |                         | ||   || || |       |  |   |                | |       | | |  |             | |     | |||                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             |||||       | |     |  |                         | ||   ***** |       |  |   |                | |       | | |  |             | |     | |||                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |||||       | |     |  |                         ***|   || || |       |  |   |                | |       | | |  |             | |     | |||                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |||||       | |     |  |                         |  |   ****| |       |  |   |                | |       | | |  |             | |     ****|                  
search RasMol script viewer Motif-ligand binding stats  nest ..             *****       ***     |  |                         |  |    | || |       |  |   |                ***       *** |  |             ***     | |||                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ****                         ****    ******       ****   |                              ****                     ****|                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                      *****                                                       *****                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                    

   New search    1xtq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors