triangle PDBeMotif: 1xox  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification apoptosis    | release date: Thu, Oct 7, 2004
Title solution structure of human survivin
Authors C.SUN, D.NETTESHEIM, E.T.OLEJNICZAK, Z.LIU
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKH
SSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKET
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : APOPTOSIS INHIBITOR SURVIVIN
member of: CATH:search1.10.1170.10GENE3D:searchG3DSA_1.10.1170.10PANTHER:searchPTHR10044/searchPTHR10044_SF88PFAM:searchPF00653PROSITE PROFILES:searchPS50143, SMART:searchSM00238SUPERFAMILY:searchSSF57924UniProt:searchO15392
JMol viewer RasMol script viewer  ZN 999A  ..                                                        *  *                *      *                                 
sec str:  ...............hhhhhhhh............hhhhhhh..eee.........eee..............hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh
sequence :  ..MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKET
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          |  |  | | |||  | |  |      || |||    |  |            |  || |  |  | **^*| | | ||| || |||| ||  |  ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |  | | ^**  | |  |      || |||    |  |            |  || |  |  | |  || | | ^** || |||| ||  |  ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |  | | ||   | |  |      || |||    ^***            |  || |  |  | |  || | |  |  || ||^***|  |  ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |  | | ||   | |  |      *****|                    |  || |  |  | |  || | |  |  || || |  |  *****         
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |  | | ||   | |  |      *****|                    |  || |  **** ****| | |  |  ****| ****  ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |  | | ||   ***  |         | |                    |  |***           | | |  |   |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |  | | ||     |  |         ***                    |  |              | | |  |   |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..          ****  | ****     ****                                ****              *** ****   ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                

chain B : APOPTOSIS INHIBITOR SURVIVIN
member of: CATH:search1.10.1170.10GENE3D:searchG3DSA_1.10.1170.10PANTHER:searchPTHR10044/searchPTHR10044_SF88PFAM:searchPF00653PROSITE PROFILES:searchPS50143, SMART:searchSM00238SUPERFAMILY:searchSSF57924UniProt:searchO15392
JMol viewer RasMol script viewer  ZN 998B  ..                                                        *  *                *      *                                 
sec str:  ...............hhhhhhhh............hhhhhhh..eee.........eee..............hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh
sequence :  ..MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKET
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          |  |  | | |||  | |  |      || |||    |  |            |  || |  |  | **^*| | | ||| || |||| ||  |  ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |  | | ^**  | |  |      || |||    |  |            |  || |  |  | |  || | | ^** || |||| ||  |  ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |  | | ||   | |  |      || |||    ^***            |  || |  |  | |  || | |  |  || ||^***|  |  ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |  | | ||   | |  |      *****|                    |  || |  |  | |  || | |  |  || || |  |  *****         
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |  | | ||   | |  |      *****|                    |  || |  **** ****| | |  |  ****| ****  ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |  | | ||   ***  |         | |                    |  |***           | | |  |   |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |  | | ||     |  |         ***                    |  |              | | |  |   |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..          ****  | ****     ****                                ****              *** ****   ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****                                                                                                

   New search    1xox:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML