triangle PDBeMotif: 1xl4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification metal transport    | release date: Thu, Sep 30, 2004
Title intermediate gating structure 1 of the inwardly rectifying k kirbac3.1
Authors A.EDWARDS, A.KUO, B.SMITH, C.ARROWSMITH, D.A.DOYLE, J.M.GULBIS, M.
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search K K binding statistics K
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INWARD RECTIFIER POTASSIUM CHANNEL
member of: CATH:search1.10.287.70/search2.60.40.1400GB:search46201166GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF39PFAM:searchPF01007PRINTS:searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchQ2W6R1
JMol viewer RasMol script viewer  MG 2001A  ..                                                                                     *                                                                                                                                                                                                           
JMol viewer RasMol script viewer  K 1004A  ..                                                                                     *                                                                                                                                                                                                           
JMol viewer RasMol script viewer  K 1003A  ..                                                                                     |**                                                                                                                                                                                                         
JMol viewer RasMol script viewer  K 1002A  ..                                                                                     ||**                                                                                                                                                                                                        
JMol viewer RasMol script viewer  K 1001A  ..                                                                                     ||||                                                                                                                                                                                                        
sec str:  ...............ee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eee...eeeeee..eeeeeeeeee.....eeeeeeeeeeeeeee.....eeeeeee......eeeee..eeeeeee..........hhhhhhhhh.eeeeeeeeee....eeeeeeeeee...eee..ee...eee.....eee.......ee.....
sequence :  ..KPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARPGSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHH
seq num:  ..11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | ||^***  |  |  | |||||| ||           |   |        |  || |  ||  |  |   ||  ||||||||         |   |        |    |   || ||   |||  |||   |  |            | | |  |             | |                            |  | || |   | | ||||           | |        || |||  |   | | || ||||  |  |  |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | || | |  |  |  | |||||| ||           |   |        |  || |  ||  |  |   ||  ||||||||         |   |        |    |   || ||   |||  ^**   |  |            | | |  |             | |                            |  | || |   ^** ||||           | |        || |||  |   | | || ||||  |  |  |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | || | |  |  |  | |||||| ||           |   |        |  || |  ||  ^***   ||  ||||||||         |   |        |    |   || ||   |||   |    ^***            | | |  |             | |                            |  | || |   | | ^***           | |        ^***||  |   | | ^***|||  |  |  |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       | || | |  |  *******^||| ||           |   |        |  || |  ||  |      ||  ||||||||         |   |        |    |   || ||   |||   |                    | | |  |             | |                            |  | || |   | | |||            | |        || |||  |   | |  | ||||  |  |  |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | || | |  |     | || ||| ||           |   |        |  || |  ||  |      ||  ||||||||         |   |        ^*****   || ||   |^*****                    | | |  |             | |                            |  | || |   | | |||            | |        || |||  |   | |  | ||||  |  |  |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | || | |  |     | || ||| ||           |   |        |  || |  ||  |      ||  ||||||||         |   |                 || ||   | |                        | | |  |             | |                            |  | || |   | | |||            | |        || |||  |   | |  | ^***  |  |  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | || | |  |     | |***** ||           |   |        |  || |  ||  |      |*****||||||         |   |                 *****   | |                        | | |  |             | |                            |  | || |   | | |||            | |        || |||  |   | |  | |||   |  |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | || | |  |     | |****| ||           |   |        ****| ********      |*******||||         |   |                 *****   | |                        | | |  |             | |                            **** || |   | ****|            | |        ****||  |   | |  ****|   *******       
search RasMol script viewer Motif-ligand binding stats  nest ..       ***| | |  |     ***  | | ||           |   |            | |  ||  |      |   | ******         |   |                         ***                        | | |  |             ***                            |  | || |   |   ***            ***         |  ||  |   | |    ***      |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..          *** ****          | ****           |   |            **********      |   |                |   |                                                    *** ****                                            *********   |   |                          ********   ***             ****       
search RasMol script viewer Motif-ligand binding stats  ststaple ..          | |               *****            *****                            *****                *****                                                                                                           | |      *****                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..          ***                                                                                                                                                                                                      ***                                                                           

chain B : INWARD RECTIFIER POTASSIUM CHANNEL
member of: CATH:search1.10.287.70/search2.60.40.1400GB:search46201166GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF39PFAM:searchPF01007PRINTS:searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchQ2W6R1
JMol viewer RasMol script viewer  MG 2001A  ..                                                                         *                                                                                                                                                                                                           
JMol viewer RasMol script viewer  K 1004A  ..                                                                         *                                                                                                                                                                                                           
JMol viewer RasMol script viewer  K 1003A  ..                                                                         |**                                                                                                                                                                                                         
JMol viewer RasMol script viewer  K 1002A  ..                                                                         ||**                                                                                                                                                                                                        
JMol viewer RasMol script viewer  K 1001A  ..                                                                         ||||                                                                                                                                                                                                        
sec str:  ................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eee...eeeeee..eeeeeeeeee.....eeeeeeeeeeeeeee.....eeeeeee......eeeee..eeeeeee..........hhhhhhhh..eeeeeeeeee....eeeeeeeeee...eee..ee...eee.....eee.hhhh..ee.....
sequence :  ..ITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARPGSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHH
seq num:  ..23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..***     |  | |||||| ||     |   | |   |     |  || |  |  ||  | || || |  |||||||||||   |  ||  |        |    |    |  |   |||  |||   |  |            | |                | | |                            |  | || |   | | | ||           | |        || |||  |   | | |  |  |  | ||  |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  | |||||| ||     |   | |   |     |  || |  |  ||  | || || |  |||||||||||   |  ||  |        |    |    |  |   |||  ^**   |  |            | |                | | |                            |  | || |   ^** | ||           | |        || |||  |   | | |  |  |  | ||  |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  | |||||| ||     |   | |   |     |  || |  |  ||  ^*** || |  |||||||||||   |  ||  |        |    |    |  |   |||   |    ^***            | |                | | |                            |  | || |   |   ^***           | |        ^***||  |   | | ^***  |  | ||  |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        *******^||| ||     |   | |   |     |  || |  |  ||  | |  || |  |||||||||||   |  ||  |        |    |    |  |   |||   |                    | |                | | |                            |  | || |   |   | |            | |        || |||  |   | |    |  |  | ||  |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | || ||| ||     |   | |   |     |  || |  |  ||  | |  || |  |||||||||||   |  ||  |        ^*****    |  |   |^*****                    | |                | | |                            |  | || |   |   | |            | |        || |||  |   | |    |  |  | ||  |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           | || ||| ||     |   | |   |     |  || |  |  ||  | |  || |  |||||||||||   |  ||  |                  |  |   | |                        | |                | | |                            |  | || |   |   | |            | |        || |||  |   | |    ^***  | ||  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | || ||| ||     |   | |   |     ***** |  |  ||  | ***** *****|||||||||   |  ||  |                  |  |   | |                        | |                | | |                            |  | || |   |   | |            | |        || |||  |   | |          | ||  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | || ||| ||     |   | |   |     |  |  |  |  ||  | |  |  |  | |||||||||   |  ||  |                  |  |   | |                        | |                | | |                            |  | || |   |   | |            | |        || |||  |   | |          ***|  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |****| ||     |   | |   |     *******  |  |**** ****  *******|||||||   |  ||  |                  ****   | |                        | |                | | |                            **** || |   |   | |            | |        ****||  |   | |             ****       
search RasMol script viewer Motif-ligand binding stats  nest ..           ***  | | ||     |   | |   |              |  ||  |            ********|   |  ||  |                         ***                        | |                | ***                            |  | || |   |   ***            ***         |  ||  |   | |             |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..                | ****     |   | |   |              ********                 ****   |  ||  |                                                    ***                | |                              *********   |   |                          ********   ***             ****       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****      ***** *****                                              ********                                                                       | |                                 | |      *****                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                   ***                                 ***                                                                           

   New search    1xl4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors