triangle PDBeMotif: 1x8b  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.112
Classification transferase    | release date: Tue, Aug 17, 2004
Title structure of human wee1a kinase: kinase domain complexed with inhibitor pd0407824
Authors C.J.SQUIRE, E.N.BAKER, I.IVANOVIC, J.M.DICKSON
Method X-RAY DIFFRACTION (resolution: 1.81Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search 824 824 binding statistics 824
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAMGMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAW
AEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEE
GDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEI
RQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : WEE1-LIKE PROTEIN KINASE
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR11042/searchPTHR11042_SF72PFAM:searchPF00069PIRSF:searchPIRSF037281PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SUPERFAMILY:searchSSF56112UniProt:searchP30291
JMol viewer RasMol script viewer  824 901A  ..              *       *            * *                 *             *               ****  *                                                  *  ..       *                                                                                                          
JMol viewer RasMol script viewer  MG 602A  ..              |       |            | |             *   |             |               ||||  |                                                  |  ..       | *                                                                                                        
JMol viewer RasMol script viewer  MG 601A  ..              |       |            | |             |   |             |               ||||  |                                                * |  ..       * |                                                                                                        
sec str:  ....hhhhhheeeeeeeeee..eeeeeeee.....eeeeeeee.....hhhhhhhhhhhhhhhhh........eeeeeee..eeeeeee.....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeee....eeee......ee.........hhhhhhhhhhh....hhhhhhhhhhhhhhhhhh........hhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhh....
sequence :  ..MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFIS..KVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVL
seq num:  ..291       301       311       321       331       341       351       361       371       381       391       401       411       421       431  ..456       466       476       486       496       506       516       526       536       546       556       566 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |     |            |  ||| | || | | |  |  ||           |  |  |                     | |  ||      | |                       | | | | || || | ..|      ||| | |  |      ||| |  || ||^***|  |            | |           || |||                 |  | || ||||   |  |  |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  |     |            |  ||| | || | | |  |  ||           |  |  |                     | |  ||      | |                       | | | | || || | ..|      ||| | |  |      ||| |  || ||| | |  |            | |           || |||                 |  | || **^*   |  |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |     |            |  ||| | || ^** |  |  ||           |  |  |                     | |  ||      | |                       | | | | || || | ..*      ||| | |  |      ||| |  || ||| | |  |            | |           || |||                 |  | || || |   |  |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |     |            |  ||| | ||     |  ^***|           |  |  |                     | ^***|      | |                       | | | | || || | ..       ||| | |  |      ||| |  || ||| | |  |            | |           || |||                 |  | || || |   |  |  |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |     |            *******^ ||     |  |   |           |  |  |                     | |  ||      | |                       | | | | || || | ..       ||| | |  |      ||| |  || ||| | |  |            | |           || |||                 |  | || || |   |  |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |     |               |^*****|     |  |   |           |  |  |                     ^*****|      | |                       | | | | || || | ..       ||| | |  |      ||| |  || ||| | |  |            | |           || |||                 |  | || || |   |  |  |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     |  |     ************************     |  |   |           |  |  |                       |   |      | |                       | | | | || || | ..       ||| | |  |      ||| |  || ||| | |  |            | |           || |||                 |  | || || |   |  |  |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     |  |                     | |          |  |   |           |  |  |                       |   |      | |                       | ****^******** ..       ||| | |  |      ||| |  || ||| | |  |            | |           || |||                 |  | || || |   |  |  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |                     ***          |  |   |           |  |  |                       |   |      | |                       | | | | || ||   ..       *** | |  |      *** |  || ||*** |  |            | |           || |||                 |  | || || |   |  |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |                     | |          ****   |           |  |  |                       |   |      | |                       | | | | || ||   ..       ||| | |  |       |  |  |****|   ****            | |           *****|                 |  | ***** |   |  ****
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                     ***          |  |   |           |  |  |                       |   |      ***                       *** *** || ||   ..       *** | |  |       |  |  |  ***                   ***              ***                 |  | ||  | |   |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                  ****   |           *******                       |   |                                      | |****   ..        **** ****       ****  |    |                                                        ********** |   ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                              |   |                                         |   |                                      | |  |    ..                              ******                                                                   |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              *****                                         *****                                      | |  |    ..                                                                                                       *****      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       * *  *    ..                                                                                                                  

   New search    1x8b:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors