triangle PDBeMotif: 1x4b  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification rna binding protein    | release date: Sat, May 14, 2005
Title solution structure of rrm domain in heterogeneous nuclear ribonucleaoproteins a2/b1
Authors F.HE, M.INOUE, M.SHIROUZU, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE (RSGI), S.YOKOYAMA, T.KIGAWA, T.TERADA, Y.MUTO
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMA
EVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         | |         |||| |  |^** ||      ||        ^**|| |      |  | ||||      |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         | |         |||| ^*** |  ||      ||        ||||| |      ^*** ||||      |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         | |         |||| |    |  ||      ||        ||||| |         | ||||      |  |             ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | |         |||| |    *****      ||        ||||| |         *****|      |  |                    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | |         |||| |    |  |       **        ||||| |         | || |      |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |         |||| |    ****                 ||||| |         ******      ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..                     ***         ******                         *******                                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                                                                             

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |                     ||||||| |^**|                  ^** | |      |  |  ||       |  |       | || || |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |                     |||||^***  ||                  | | | |      ^***  ||       |  |       | || || |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****                     ||||||| |  ||                  | | | |         |  ||       |  |       | || |^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                 ||||||| *****                  | | | |         *****       |  |       | || || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                 ||||||| ****                   | | | |         ****        ****       | || || |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                 ||||***                        | | | |                                ***| || |    
search RasMol script viewer Motif-ligand binding stats  nest ..                                 ******                         *** ***                                   ******    

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         | | |  |    |||| |  |^** ||      ||     | |^**|| |      |  |  || ||    |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         | | |  |    |||| ^*** |  ||      ||     | |||||| |      ^***  || ||    |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         | | |  |    |||| |    |  ||      ||     | |||||| |         |  || ||    |  |             ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | | |  |    |||| |    *****      ||     | |||||| |         ********    |  |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     | | |  |    |||| |    |  |       ||     ***||||| |         |  |  |     |  |                    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | | |  |    |||| |    |  |       **        ||||| |         |  |  |     |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | | |  |    |||| |    ****                 ||||| |         *******     ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..                     *** |  |    ******                         *******                                             
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |             |  |    ||||||| |^** ||      ||        ^** | |      |  |  || | |            ||||    | | || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |             |  |    |||||^*** |  ||      ||        | | | |      ^***  || | |            ||||    | | || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****             |  |    |||||||   |  ||      ||        | | | |         |  || | |            ||||    ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                         |  |    |||||||   *****      ||        | | | |         ***** | |            ||||      | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                         |  |    |||||||   |  |       **        | | | |         |  |  | |            ||||      | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |  |    |****||   ****                 | | | |         ****  | |            ||||      | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |    ||||***                        | | | |               | |            ||||      | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ******                         *** ***               | |            ****      | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                         ***                      ***  

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |          |  |  |    |||| |  |^** ||    | ||        ^**|| |      |  | |||||||   |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |          |  |  |    |||| ^*** |  ||    | ||        ||||| |      ^*** |||||||   |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****          |  |  |    ||||      |  ||    | ||        ||||| |         | |||||||   |  |     | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  |  |    ||||      *****    | ||        ||||| |         ********|   |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                      |  |  |    ||||      |  |     | **        ||||| |         | |||||||   |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ****  |    ||||      ****     | |         ||||| |         ********|   ****     | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |    |***               ***         ||||| |               | |            | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ***                            *******               | |            ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                         ***                           

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |          |  |  |    |||||||||^** ||    | |      | |^** | |      | || |||||     |  |         | | |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |          |  |  |    |||||^*** || ||    | |      | || | | |      ^*** |||||     |  |         | | |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****          |  |  |    ||||||||  || ||    | |      | || | | |        || |||||     |  |         | | ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  |  |    |||||||********    | |      | || | | |        ********     |  |         | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                      |  |  |    ||||||||  |  |     | |      ***| | | |        || || |      |  |         | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ****  |    |||||||*******     | |         | | | |        *******      ****         | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |    |******            ***         | | | |                                  | |        
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ***| |                         *** ***                                  ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****       ***                                                                             

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |             |  |    |||| |  |^** ||                ^** | |      | || |||||     |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |             |  |    |||| ^*** |  ||                | | | |      ^*** |||||     |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****             |  |    ||||      |  ||                | | | |        || |||||     |  |             ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                         |  |    ||||      *****                | | | |        ********     |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |  |    ||||      ****                 | | | |        *******      ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |    |***                           | | | |                                             
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ***                            *** ***                                             
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || || |       | |   |  |    |||| |  |^** ||      ||        ^** | |      |  | ||||| |            | |     |   |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***| |       | |   |  |    |||| ^*** |  ||      ||        | | | |      ^*** ||||| |            | |     |   |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****       | |   |  |    |||| |    |  ||      ||        | | | |         | ||||| |            | |     ^*****|
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |       | |   |  |    |||| |    *****      ||        | | | |         ******* |            | |         | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..         | |       | |   |  |    |||| |    |  |       **        | | | |         | || || |            | |         | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |       | |   |  |    |||| |    ****                 | | | |         ******| |            | |         | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |       ***   |  |    |||| |                         | | | |               | |            | |         ***
search RasMol script viewer Motif-ligand binding stats  nest ..         ***             |  |    ******                         *** ***               | |            ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****       ***                                               ***                           

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |            || ||    |||| |  |^**|||                ^** | |      |  |  ||       |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |            || ||    |||| ^*** |||||                | | | |      ^***  ||       |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****            || ||    |||| |  | |||||                | | | |         |  ||       |  |     | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        *****    |||| |  *******                | | | |         *****       |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        ****|    |||| |  ******                 | | | |         ****        ****     | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ******                         *** ***                              ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         | | |  |    ||||||| |^**|        ||        ^** | |      |  |  ||       |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         | | |  |    |||||^***  ||        ||        | | | |      ^***  ||       |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         | | |  |    ||||| | |  ||        ||        | | | |         |  ||       |  |     | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | | |  |    ||||| | *****        ||        | | | |         *****       |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | | |  |    ||||| | |  |         **        | | | |         |  |        |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | | |  |    ||||| | ****                   | | | |         ****        ****     | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     | | |  |    |******                        | | | |                              | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                     *** |  |    ***                            *** ***                              ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |           | || |    ||||||  |^** ||                ^** | |      |  | |||||||   |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |           | || |    |||||^*** |  ||                | | | |      ^*** |||||||   |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****           | || |    ||||||    |  ||                | | | |         | |||||||   |  |     | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | || |    ||||||    *****                | | | |         *******||   |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       **** |    |****|    ****                 | | | |         ********|   ****     | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ******                         *** ***               | |            ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                         ***                           

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |           |  |      |||| |  |^** ||             | |^**|| |      |  |  || ||    |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |           |  |      |||| ^*** |  ||             | |||||| |      ^***  || ||    |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****           |  |      |||| |    |  ||             | |||||| |         |  || ||    |  |     | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       |  |      |||| |    *****             | |||||| |         ********    |  |     | |            
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                       |  |      |||| |    |  |              *****||| |         |  |  |     |  |     | |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                       |  |      |||| |    |  |              ***||||| |         |  |  |     |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       ****      |||| |    ****                 ||||| |         *******     ****     | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                 |*** |                         ||||| |                              | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                                 ***| |                         *******                              | |            
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ***                                                              ***            

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         |  |        ||||||| |^** ||      ||        ^**|| |      |  |  ||       |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         |  |        |||||^*** |  ||      ||        ||||| |      ^***  ||       |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         |  |        |||||||   |  ||      ||        ||||| |         |  ||       |  |             ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     |  |        |||||||   *****      ||        ||||| |         *****       |  |                    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     |  |        |||||||   |  |       **        ||||| |         |  |        |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ****        |****||   ****                 ||||| |         ****        ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                 ||||***                        ||||| |                                             
search RasMol script viewer Motif-ligand binding stats  nest ..                                 ******                         *******                                             

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |            || ||    ||||||| |^**|        ||        ^** | |    | |  |  |  |                      |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |            || ||    |||||^***  ||        ||        | | | |    | ^***  |  |                      |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****            || ||    ||||||| |  ||        ||        | | | |    | |     |  |                      ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                        || ||    ||||||| *****        ||        | | | |    | |     |  |                             
search RasMol script viewer Motif-ligand binding stats  betabulge ..                        || ||    ||||||| |  |         **        | | | |    | |     |  |                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..                        *****    ||||||| ****                   | | | |    | |     ****                             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |    ||||***                        | | | |    | |                                      
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ******                         *** ***    | |                                      
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                              ***                                      

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         |  |        ||||||  |^** ||                ^** | |      |  |  || |     |  |         | | |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         |  |        |||||^*** |  ||                | | | |      ^***  || |     |  |         | | |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         |  |        ||||||    |  ||                | | | |         |  || |     |  |         | | ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     |  |        ||||||    *****                | | | |         ***** |     |  |         | | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ****        |****|    ****                 | | | |         *******     ****         | | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                 |||| |                         | | | |                                  *****      
search RasMol script viewer Motif-ligand binding stats  nest ..                                 ******                         *** ***                                             

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         |  ||  |    |||| |  |^**||                 ^** | |      | || ||| ||    |  |     ||||    |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         |  ||  |    |||| ^***| |||                 | | | |      ^*** ||| ||    |  |     ||||    |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         |  ||  |    |||| |  || |||                 | | | |        || ||| ||    |  |     ||||    ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     |  ||  |    |||| |  ******                 | | | |        *********    |  |     ||||           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ********    |||| |  *****                  | | | |        ********     ****     ||||           
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ******                         *** ***                              ****           
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         | |         ||||||| |^** ||                ^** | |      |  |  ||       |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         | |         |||||^*** |  ||                | | | |      ^***  ||       |  |             |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         | |         ||||| |   |  ||                | | | |         |  ||       |  |             ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | |         ||||| |   *****                | | | |         *****       |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |         ||||| |   ****                 | | | |         ****        ****                    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     | |         |******                        | | | |                                             
search RasMol script viewer Motif-ligand binding stats  nest ..                     ***         ***                            *** ***                                             

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |   | |   | | ||||    |||| |  |^**         ||        ^**|| |      |  |  ||       |  |           | |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |   | |   | | ||||    |||| ^***  |         ||        ||||| |      ^***  ||       |  |           | |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****   | |   | | ||||    |||| |  |  |         ||        ||||| |         |  ||       |  |           | ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               | |   | *****|    |||| |  |  |         ||        ||||| |         *****       |  |           | |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..               | |   | | || |    |||| |  |  |         **        ||||| |         |  |        |  |           | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..               | |   | **** |    |||| |  ****                   ||||| |         ****        ****           | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               ***   | | |  |    |||| |                         ||||| |                                    ***      
search RasMol script viewer Motif-ligand binding stats  nest ..                     *** |  |    ******                         *******                                             
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |         | | |  |    ||||||| |^** ||    | ||        ^** | |      |  |  || ||    |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |         | | |  |    |||||^*** |  ||    | ||        | | | |      ^***  || ||    |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****         | | |  |    |||||||   |  ||    | ||        | | | |         |  || ||    |  |     | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | | |  |    |||||||   *****    | ||        | | | |         ********    |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     | | |  |    |||||||   |  |     | **        | | | |         |  |  |     |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | | |  |    |****||   ****     | |         | | | |         *******     ****     | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     | | |  |    ||||***            ***         | | | |                              | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                     *** |  |    ******                         *** ***                              ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
member of: CATH:search3.30.70.330GENE3D:searchG3DSA_3.30.70.330PANTHER:searchPTHR24012/searchPTHR24012_SF329PFAM:searchPF14259PROSITE PROFILES:searchPS50102, SMART:searchSM00360SUPERFAMILY:searchSSF54928UniProt:searchP22626
sec str:  ........................hhhhh.eeeee.......hhhhhhhh.......eeeee..........eeeee...hhhhhhhh....eee..eeeeee...............
sequence :  ..GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |  |             |  |    ||||||  |^** ||    | |      | |^**|| |      |  |  ||       |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ^***  |             |  |    |||||^*** |  ||    | |      | |||||| |      ^***  ||       |  |     | |     |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****^*****             |  |    ||||||    |  ||    | |      | |||||| |         |  ||       |  |     | |     ^***** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                         |  |    ||||||    *****    | |      | |||||| |         *****       |  |     | |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         |  |    ||||||    |  |     | |      ***||||| |         |  |        |  |     | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |  |    |****|    ****     | |         ||||| |         ****        ****     | |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |    |||| |             ***         ||||| |                              | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |    ******                         *******                              ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****                                                                                       

   New search    1x4b:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML