triangle PDBeMotif: 1x0o  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription    | release date: Fri, Mar 25, 2005
Title human arnt c-terminal pas domain
Authors K.H.GARDNER, P.B.CARD, P.J.ERBEL
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRS
KNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |          | ||| || | |||  | || |||| || || ||  |    |  ||||||| |    |     | |||            | || |            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |          | ||| ^*** |||  | || |||| || || ||  |    |  ||||||| |    |     | |||            | || |             ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | || |||| || || ||  |    |  ||||||| ^*****     | |||            | || |              | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |          | ||| || | |||  | || |||| || || ||  |    **********            | |||            | || |              | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |          ***** || *****  | || |||| || || ||  |    |  | || |             | |||            | || |              | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ***          ***|| || ***|   | || |||| || || ||  |    |  | || |             | |||            | || |              | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |          | ||| ** |  |   | || |||| || || ||  |    |  | || |             | |||            | || |              | |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | |          *****    |  |   | || |||| || || ||  |    |  | || |             | |||            ******              | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |          ****|    ****   | |************ |****    *********             ****|            | || |              | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |            | |           | |  | || |  |  |                                | |            ***| |              ***
search RasMol script viewer Motif-ligand binding stats  nest ..   ***            ***           ***  | || |  |  |                                ***               ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****                                                                      

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   || |        | ||| || | ||  || |  | || || |  ||  | || | ||||||   |    |     | |||            | |||             ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   || |        | ||| ^*** ||  || |  | || || |  ||  | || | ||||||   |    |     | |||            | |||             |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^***** |        | ||| || | ||  || |  | || || |  ||  | || | ||||||   ^*****     | |||            | |||             | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |  |        | ||| || | ||  || |  | || || |  ||  | || ********              | |||            *****             | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |  |        ***** || | ||  || |  | || || |  ||  | || | || ||               | |||            *****             | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  |        | ||| || | ||  || |  | || |***  ||  | || | || ||               | |||            ***|              ***  
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |  |        | ||| ** | ||  || |  | || |  |  ||  | || | || ||               | |||            |  |                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    |  |        *****    | ||  || |  | || |  |  ||  | || | || ||               *****            |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |        ****|    ****  || |  **** |  ******** **********               ****|            ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |          ***      |   |***  | || |  |  |      |   |                     ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..    ****                   |   |     ******  ****      |   |                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                       *****                                                           

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || | |||  | |  | || || |  ||  |||| |||||||  |||    |     | |||            | |||             ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** |||  | |  | || || |  ||  |||| |||||||  |||    |     | |||            | |||              ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | |  | || || |  ||  |||| |||||||  ||^*****     | |||            | |||              | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || | |||  | |  | || || |  |*****|*******|*****           | |||            *****              | | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | ||| || *****  | |  | || || |  ||  | || |||| ||  |            | |||            *****              | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||| || ***|   | |  | || |***  ||  | || |||| ||  |            | |||            ***|               | | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | |  | || |  |  ||  | || |||| ||  |            | |||            |  |               | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | |  | || |  |  ||  | || |||| ||  |            | |||            |  |               | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |  | || |  |  |**** *************            ****|            ****               | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |                              | ***                               *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****                              | | |                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                               *****                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                               ***                                     

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |  | |     | ||| || |  |   | |  | || |  |  ||  || ||| ||||| || |    |     | |||            |  |||            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |  | |     | ||| ^***  |   | |  | || |  |  ||  || ||| ||||| || |    |     | |||            |  |||             ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****  | |     | ||| || |  |   | |  | || |  |  ||  || ||| ||||| || ^*****     | |||            |  |||                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |     | ||| || |  |   | |  | || |  |  ||  |************** |          | |||            *****|                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |     | ||| ** |  |   | |  | || |  |  ||  || ||| || || || |          | |||            |  | |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        | |     *****    |  |   | |  | || |  |  ||  || ||| || || || |          *****            ******                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |     ****|    ****   | |  **** |  ********************** |          ****|            **** |                 
search RasMol script viewer Motif-ligand binding stats  nest ..        | |       ***           ***  | || |  |  |      |   |      ***            ***               ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..        ***                          ******  ****      |   |                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                           

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || | |||  | || |||| || |||||  ||||||||||||||| ||   |     | | |            | ||||           |^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** |||  | || |||| || |||||  ||||||||||||||| ||   |     | | |            | ||||           ||^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | || |||| || |||||  ||||||||||||||| ^*****     | | |            | ||||           ||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || | |||  | |*****| || ||||*****************|  |         | | |            | ||||           ||||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | ||| || *****  | || |||| |*****||  ||||||||||||| |  |         | | |            *****|           ||||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||| || ***|   | || |||| |***| ||  ||||||||||||| |  |         | | |            ***| |           ||||  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | || |||| || || ||  ||||||||||||| |  |         | | |               | |           ||||  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | || |||| || || ||  ||||||||||||| |  |         | | |               | |           ||||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |****|| |********************** ****         | | |               | |           ||||  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  | |           | |  | || |  |  |                              | | |               | |           ***|  
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |                              | ***               ***            | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****                              | |                                ***  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                               ***                                     

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| | |          | ||| |  | ||| || || |||| || |||||  ||| |||||||  || |    |     | |||            |  ||             ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|| | |          | ||| ^*** ||| || || |||| || |||||  ||| |||||||  || |    |     | |||            |  ||             |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | |||    | ||| || || |||| || |||||  ||| |||||||  || ^*****     | |||            |  ||             | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | | |          | |||    | ||| || |*****| || |||||  |**************            | |||            *****             | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | | |          | |||    ***** || || |||| |*****||  ||| |||||||  |             | |||            |  |              | |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. | | |          | |||    ***|  || || |||| |***| ||  ||| |||||||  |             | |||            |  |              | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. | | |          *****    | ||  || || |||| || || ||  ||| |||||||  |             | |||            |  |              | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | | |          ****|    ****  || |****|| |***********************             ****|            ****              | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn .. *****            | |      |   || |  | || |  |  |                                | |                              ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***      |   |***  | || |  |  |                                ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                           |   |     ******  ****                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                                                                       

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| |  | |||  | || |||| || || ||  || |   |  |  || |    |     | |||            | ||||            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** |||  | || |||| || || ||  || |   |  |  || |    |     | |||            | ||||             ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | |||    | |||  | || |||| || || ||  || |   |  |  || ^*****     | |||            | ||||                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | |||    | |||  | |*****| || || |***** |   |  *****            | |||            | ||||                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | |||    *****  | || |||| || || ||  |  |   |  |  |             | |||            *****|                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | |||    ***|   | || |||| || || ||  |  |   |  |  |             | |||            ***| |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | || |||| || || ||  |  |   |  |  |             | |||            |  | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |****|| |**** |****  |   |  ****             ****|            **** |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |      |   |                   | ***               ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****      |   |                   | | |                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                       |   |                   *****                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                   | |                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                               ***                                     

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || |  |   | |  | || || |||||  || ||||||||||||||    |     | |||            | || |            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^***  |   | |  | || || |||||  || ||||||||||||||    |     | |||            | || |             ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || |  |   | |  | || || |||||  || |||||||||||||^*****     | |||            | || |             | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || |  |   | |  | || |*****|*******************           | |||            | || |             | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||| || |  |   | |  | || || || ||  || ||||||||||||            | ***            ***| |             | | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | |  | || || || ||  || ||||||||||||            | |||            |  | |             | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | |  | || || || ||  || ||||||||||||            | |||            ******             | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |  | ******** |******************            ****|               | |             | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |      |   |                     ***               ***             *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****      |   |                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                           

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |          | ||| || | |||  | |  | || |  |  ||  ||| ||||||||| ||||   |     | |||                              ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |          | ||| ^*** |||  | |  | || |  |  ||  ||| ||||||||| ||||   |     | |||                               ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | |  | || |  |  ||  ||| ||||||||| ||^*****     | |||                                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |            | ||| || | |||  | |  | || |  |  ||  |************ || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |            | ||| || *****  | |  | || |  |  ||  ||| || || ||| || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |            | ||| || ***|   | |  | || |  |  ||  ||| || || ||| || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |            | ||| ** |  |   | |  | || |  |  ||  ||| || || ||| || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..|  |            *****    |  |   | |  | || |  |  ||  ||| || || ||| || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |            ****|    ****   | |  | ****  *******************| ****         ****|                                   
search RasMol script viewer Motif-ligand binding stats  nest ..|  |              ***           ***  | || |  |  |               | || |         | ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..****                                 ******  ****               ******         | | |                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                               *****                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                               ***                                     

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || | |||  | || |||| |||| |||  || |   |  || || |    |     | |||            | |||           ||^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** |||  | || |||| |||| |||  || |   |  || || |    |     | |||            | |||           || ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | || |||| |||| |||  || |   |  || || ^*****     | |||            | |||           || | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || | |||  | || |||| |||| ||***** |   ********            | |||            *****           || | | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | ||| || *****  | || |||| |||| |||  |  |   |  || ||            | |||            *****           || | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||| || ***|   | || |||| |*** |||  |  |   |  || ||            | |||            ***|            || | | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | || |||| | || |||  |  |   |  || ||            | |||            |  |            ** | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | || |||| | || |||  |  |   |  || ||            | |||            |  |               | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |******** *********  |   ********            ****|            ****               | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  | |           | |  | || |  |  |      |   |                     | |                               *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |      |   |                     ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****      |   |                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       *****                                                           

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || | |||  | || |||| || |||||  ||||||||||||| ||||   |     | |||            |  | |            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** |||  | || |||| || |||||  ||||||||||||| ||||   |     | |||            |  | |            |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | || |||| || |||||  ||||||||||||| ||^*****     | |||            |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || | |||  | |*****| || ||||***************| || |         | |||            |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | ||| || *****  | || |||| |*****||  | ||||||| ||| || |         | |||            |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||| || ***|   | || |||| |***| ||  | ||||||| ||| || |         | ***            |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | || |||| || || ||  | ||||||| ||| || |         | |||            |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | || |||| || || ||  | ||||||| ||| || |         | |||            |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |****|| |**** |**** ****************         ****|            **** |            | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  | |           | |  | || |  |  |               | || |           | |               | |            ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |               | || |           ***               ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****               ******                                                 

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || | |||  | |  | || || || ||  | || ||||||| || |    |     | |||            | |||             ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** |||  | |  | || || || ||  | || ||||||| || |    |     | |||            | |||              ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | |  | || || || ||  | || ||||||| || ^*****     | |||            | |||               | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || | |||  | |  | || || || ||  | |************            | |||            *****               | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                ***** || *****  | |  | || || || ||  | || |||| |  |             | |||            *****               | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..                ***|| || ***|   | |  | || || || ||  | || |||| |  |             | |||            ***|                | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | |  | || || || ||  | || |||| |  |             | |||            |  |                | |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | |  | || || || ||  | || |||| |  |             | |||            |  |                | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |  | || |********** ************             ****|            ****                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |                                ***                                ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****                                                                      

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |          | ||| || | ||| || |  | || || || ||  ||||||||||||||| ||   |     | |||            |  ||             ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |          | ||| ^*** ||| || |  | || || || ||  ||||||||||||||| ||   |     | |||            |  ||              ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | ||| || |  | || || || ||  ||||||||||||||| ^*****     | |||            |  ||              | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |          | ||| || | ||| || |  | || || || |*****||***********  |         | |||            *****              | | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |          | ||| || ***** || |  | || || || ||  | |||||||||| ||  |         | |||            |  |               | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |          | ||| || ***|  || |  | || || || ||  | |||||||||| ||  |         | |||            |  |               | | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |          | ||| ** | ||  || |  | || || || ||  | |||||||||| ||  |         | |||            |  |               | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | |          *****    | ||  || |  | || || || ||  | |||||||||| ||  |         *****            |  |               | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |          ****|    ****  || |  | || |**** |**** ****************         ****|            ****               | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |            | |      |   || |  | || |  |  |                                | |                               *** 
search RasMol script viewer Motif-ligand binding stats  nest ..   ***            ***      |   |***  | || |  |  |                                ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                     |   |     ******  ****                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                                                                       

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |          | ||| || | |||  | || |||| |  |  ||  ||   | |||||| ||||   |     | |||                              ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |          | ||| ^*** |||  | || |||| |  |  ||  ||   | |||||| ||||   |     | |||                               ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | || |||| |  |  ||  ||   | |||||| ||^*****     | |||                                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |          | ||| || | |||  | |*****| |  |  |*****   ******** || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |          | ||| || *****  | || |||| |  |  ||  |    | || ||| || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |          | ||| || ***|   | || |||| |  |  ||  |    | || ||| || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |          | ||| ** |  |   | || |||| |  |  ||  |    | || ||| || |         | |||                                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | |          *****    |  |   | || |||| |  |  ||  |    | || ||| || |         *****                                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |          ****|    ****   | |****|| |  |  |****    *******| ****         ****|                                   
search RasMol script viewer Motif-ligand binding stats  nest ..   ***            ***           ***  | || |  |  |               | || |           ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****               ******                                                 

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |          | ||| || | |||  | || |||| |  |  ||  ||  |||||||  || |    |     | |||                              ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |          | ||| ^*** |||  | || |||| |  |  ||  ||  |||||||  || |    |     | |||                               ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | || |||| |  |  ||  ||  |||||||  || ^*****     | |||                                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |          | ||| || | |||  | |*****| |  |  |******************            | |||                                   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |          | ||| || *****  | || |||| |  |  ||  ||  |||||||  |             | |||                                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ***          | ||| || ***|   | || |||| |  |  ||  ||  |||||||  |             | |||                                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | || |||| |  |  ||  ||  |||||||  |             | |||                                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | || |||| |  |  ||  ||  |||||||  |             | |||                                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | |****|| |  |  |*****************             ****|                                   
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |                                ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****                                                                      

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||          | ||| || | |||  | |  | || |  |  ||  ||        || || |    |     | |||            | ||||            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | ||          | ||| ^*** |||  | |  | || |  |  ||  ||        || || |    |     | |||            | ||||             ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | |||  | |  | || |  |  ||  ||        || || ^*****     | |||            | ||||             | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |           | ||| || | |||  | |  | || |  |  |*****        *****            | |||            *****|             | | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |           | ||| || *****  | |  | || |  |  ||  |         || ||            | |||            *****|             | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |           | ||| || ***|   | |  | || |  |  ||  |         || ||            | |||            ***| |             | | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | |           | ||| ** |  |   | |  | || |  |  ||  |         || ||            | |||            |  | |             | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | |           *****    |  |   | |  | || |  |  ||  |         || ||            *****            ******             | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |           ****|    ****   | |  | || |  ********         *****            ****|            **** |             | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***             | |           | |  | || |  |  |                                | |               | |             *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |                                ***               ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****                                                                      

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||          | ||| || | ||| || |  | || || ||||     |  | |  ||  | ||   |     | |||            | |||             ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| | ||          | ||| ^*** ||| || |  | || || ||||     |  | |  ||  | ||   |     | |||            | |||             |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | ||| || |  | || || ||||     |  | |  ||  | ^*****     | |||            | |||             | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |           | ||| || | ||| || |  | || || ||||     |  | *****  |  |         | |||            *****             | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |           ***** || ***** || |  | || |*****|     |  | |  |   |  |         | |||            *****             | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |           ***|| || ***|  || |  | || |***| |     |  | |  |   |  |         | |||            ***|              ***  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | |           | ||| ** | ||  || |  | || || || |     |  | |  |   |  |         | |||            |  |                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | |           *****    | ||  || |  | || || || |     |  | |  |   |  |         | |||            |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |           ****|    ****  || |  **** |**** |     **** ****   ****         ****|            ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..  ***             ***      |   |***  | || |  |  |                              | ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..  ***                      |   |     ******  ****                              | | |                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                           |   |                                               *****                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                               | |                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                               ***                                     

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || | ||  || || |||| || |  ||  || | | || ||| ||||   |     | |||            | ||||            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** ||  || || |||| || |  ||  || | | || ||| ||||   |     | |||            | ||||            |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || | ||  || || |||| || |  ||  || | | || ||| ||^*****     | |||            | ||||            | |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || | ||  || |*****| || |  |***** | | *****| || |         | |||            | ||||            | |||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | ||| || | ||  || || |||| || |  ||  |  | | || | | || |         | |||            *****|            | |||
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||| || | ||  || || |||| |***  ||  |  | | || | | || |         | |||            ***| |            | |||
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** | ||  || || |||| |  |  ||  |  | | || | | || |         | |||            |  | |            | |||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    | ||  || || |||| |  |  ||  |  | | || | | || |         | |||            |  | |            | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****  || |****|| |  |  |****  | ****** | ****         ****|            **** |            ****|
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***      |   |***  | || |  |  |      |   |    | || |         | ***               ***            *****
search RasMol script viewer Motif-ligand binding stats  niche ..                           |   |     ******  ****      |   |    ******         | | |                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                           |   |                       |   |                   *****                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                       *****                   | |                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                               ***                                     

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| |  | ||| || |  | || || || ||  ||  || |  ||  | |    |     | |||            |  |||            ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^*** ||| || |  | || || || ||  ||  || |  ||  | |    |     | |||            |  |||             ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | |||    | ||| || |  | || || || ||  ||  || |  ||  | ^*****     | |||            |  |||                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | |||    | ||| || |  | || || || ||  |***** *****  |            | |||            *****|                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | |||    ***** || |  | || || || ||  ||  |  |  ||  |            | |||            *****|                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | |||    ***|  || |  | || || || ||  ||  |  |  ||  |            | |||            |  | |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    | ||  || |  | || || || ||  ||  |  |  ||  |            | |||            ******                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****  || |  | ****************************            ****|            **** |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***      |   |***  | || |  |  |                                ***               ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                           |   |     ******  ****                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                                                                       

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
member of: CATH:search3.30.450.20GENE3D:searchG3DSA_3.30.450.20PANTHER:searchPTHR23042/searchPTHR23042_SF50PFAM:searchPF14598PRINTS:searchNCTRNSLOCATRPROSITE PROFILES:searchPS50112, SMART:searchSM00086/searchSM00091SUPERFAMILY:searchSSF55785TIGRFAMS:searchTIGR00229UniProt:searchP27540
sec str:  ............eeeeee.....eeee..hhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhh...eeeeeeee.....eeeeeeeeeeee......eeeeeeeeee.......
sequence :  ..GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |          | ||| || |  |   | | || || |  |  ||  ||  || |  || || |    |     | |||            | |||             ^***|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |          | ||| ^***  |   | | || || |  |  ||  ||  || |  || || |    |     | |||            | |||              ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****          | ||| || |  |   | | || || |  |  ||  ||  || |  || || ^*****     | |||            | |||                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||| || |  |   | | ***** |  |  |********* ********            | |||            *****                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | ||| || |  |   | | || || |  |  ||  ||  |  |  || ||            | |||            *****                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||| || |  |   | | || || |  |  ||  ||  |  |  || ||            | |||            ***|                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | ||| ** |  |   | | || || |  |  ||  ||  |  |  || ||            | |||            |  |                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                *****    |  |   | | || || |  |  ||  ||  |  |  || ||            | |||            |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|    ****   | | *******  |  |******************            ****|            ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***           ***  | || |  |  |                                ***                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ******  ****                                                                      

   New search    1x0o:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML