triangle PDBeMotif: 1wz0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification structural genomics, unknown function    | release date: Mon, Feb 21, 2005
Title solution structure of human sumo-2 (smt3b), a ubiquitin- like protein
Authors C.ZHAO, K.SAITO, M.INOUE, RIKEN, S.KOSHIBA, S.YOKOYAMA, STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE (RSGI), T.KIGAWA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTP
AQLEMEDEDTIDVFQQQTSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |||||                    |    |     | |||  | |  ||| |||| | |     |   ^***    | |              | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |||||                    |    |     **^*|  | |  ||| |||| | |     |   || |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |||||                    |    |     |  ||  | |  ||| |||^** |     |   || |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****||||                    ^*****     |  ||  | |  ||| |||  | |     ^***** |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ||||                               |  ||  | *****| |||  | |         |  |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ||||                               |  |**** **** ****|  | |         ****    | |              | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |***                               |  |            | |  | |         |  |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  nest ..      ***                                |  |            ***  | |         |  |    ***              | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****                 ***         ****                     ***  

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                        |    |     | |||| ||| |||| ||||||||     |   ^***    | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                        |    |     **^*|| ||| |||| ||||||||     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                        |    |     |  ||| ||| |||| |||^**||     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                        ^*****     |  ||| ||| |||| ||||| ||     ^***** |    | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                         |  ||*********| |||*****         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                         |  |*********|****|****|         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..                                         |  |         |  *** |  |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****         |    | ****         ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |     | |  | || |        |    |     | ||     |  ||| |||||| |   | ||  ^***    | ||  |    | |   |  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |     | |  | || |        |    |     **^*     |  ||| |||||| |   | ||  || |    | ||  |    | |   |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |     | |  | || |        |    |              |  ||| |||^** |   | ||  || |    | ||  |    | |   |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     | |  | || |        ^*****              |  ||| ||| |  |   | ^***** |    | ||  |    | |   |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |  | || |                            *****| ||| |  |   |  |  |  |    | ||  |    | |   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |  | || |                            ****|****| ****   ****  ****    | ||  |    | |   |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |  | || |                                |  | | |  |         |  |    | ||  |    ***   |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..           | |  | || |                                |  *** |  |         |  |    ***|  |          |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..           ***  ******                                |    | ****         ****       ****          **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |     | |                |    |     | |||  | |  ||| |||||| |     |   ^***    | ||  |               
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |     | |                |    |     **^*|  | |  ||| |||||| |     |   || |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |     | |                |    |     |  ||  | |  ||| |||^** |     |   || |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     | |                ^*****     |  ||  | |  ||| ||| |  |     ^***** |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |                           |  ||  | *****| ||| |  |         |  |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |                           ******** ****|****| |  |         |  |    | |****               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           ***                           |  |         |  | | |  |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..                                         |  |         |  *** |  |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****         |    | ****         ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |    |  |                |    |     | |||| |||||||||| |||| |     |   ^***    | ||  |          | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |    |  |                |    |     **^*|| |||||||||| |||| |     |   || |    | ||  |          | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |    |  |                |    |     |  ||| |||||||||| |^** |     |   || |    | ||  |          | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****    |  |                ^*****     |  ||| |||||||||| | |  |     ^***** |    | ||  |          | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |                           |  ||| ||*******| | |  |         |  |    | ||  |          | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |                           |  |*********** | | |  |         |  |    | |****          | |  
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |                           |  |            *** |  |         |  |    ***              | |  
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                           ****                ****         ****                     ***  

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |||                       | | ||     | ||     || ||| | || | |     |   ^***    | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|   |||                       | | ||     **^*     || ||| | || | |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |||                       | | ||     |  |     || ||| | |^** |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|                       ^*****     |  |     || ||| | || | |     ^***** |    | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |                         | |      |  |     ****** | || | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |                         | |      |  |     *****  | || | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..    ***                         ***      |  |            ***| | |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****               | ***         ****                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                            ***                                         

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |     |  |               |    |     | ||     || ||  | || | |     |   ^***    | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |     |  |               |    |     **^*     || ||  | || | |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |     |  |               |    |     |  |     || ||  | |^** |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     |  |               ^*****     |  |     || ||  | |  | |     ^***** |    | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |                          |  |     *****  | |  | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |                          |  |     *****  | |  | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |                          |  |            ***  | |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                          ****                 ***         ****                          

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   || |||||   | |            | | ||     | |||  ||| |||| |||||| |     |   ^***    | |                | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|   || |||||   | |            | | ||     **^*|  ||| |||| |||||| |     |   || |    | |                | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   || |||||   | |            | | ||         |  ||| |||| |||^** |     |   || |    | |                | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^***** |||||   | |            ^*****         |  ||| |||| ||| |  |     ^***** |    | |                | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |  |||||   | |              | |          |  |******| ||| |  |         |  |    | |                | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |||||   | |              | |          *********|****| |  |         ****    | |                | |
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |****   ***              ***                   |  *** |  |         |  |    ***                ***
search RasMol script viewer Motif-ligand binding stats  niche ..    ****       ***                                    |    | ****         ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |  | |                   |    |     | ||     |  ||| |||||| |     |   ^***    ||||  |         |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |  | |                   |    |     **^*     |  ||| |||||| |     |   || |    ||||  |         |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |  | |                   |    |     |  |     |  ||| |||^** |     |   || |    ||||  |         |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****  | |                   ^*****     |  |     |  ||| ||| || |     ^***** |    ||||  |         |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |                              |  |     *****| ||| || |         |  |    ||||  |         |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |                              |  |     ****|****| ****         |  |    |||****         ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ***                              |  |         |  | |  | |         |  |    |***            |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..                                         |  |         |  ***  | |         |  |    ***             |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****         |    |  ***         ****                    ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |         | |            |||| |     | || |  | |  || |||| |       |   ^*** || |||                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |         | |            |||| |     **^* |  | |  || |||| |       |   || | || |||                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |         | |            |||| |     |  | |  | |  || |||^**       |   || | || |||                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****         | |            ^*****     |  | |  | |  || |||          ^***** | || |||                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               | |            ||||       |  | |  | ***** |||              |  | || |||                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..               | |            ||||       |  | **** ********|              **** |****|                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               ***            ||||       |  |         |  | |              |  | |  | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..                              ****       |  |         |  ***              |  | |  ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****         |    |              **** |    |                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                   ******                   

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |                        | | ||     | |||| |||  ||  | |||| |     |   ^***    ||||       | |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |                        | | ||     **^*|| |||  ||  | |||| |     |   || |    ||||       | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |                        | | ||     |  ||| |||  ||  | |^** |     |   || |    ||||       | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                        ^*****     |  ||| |||  ||  | | |  |     ^***** |    ||||       | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                | |      |  ||| ||*****  | | |  |         |  |    ||||       | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                | |      |  |*********   | | |  |         |  |    ||||       | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                | |      |  |            | | |  |         |  |    |***       ***        
search RasMol script viewer Motif-ligand binding stats  nest ..                                ***      |  |            *** |  |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****                ****         ****                          

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |    |  |                | | ||     | |||| |||  ||  | || | |     |   ^***    | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |    |  |                | | ||     **^*|| |||  ||  | || | |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |    |  |                | | ||     |  ||| |||  ||  | |^** |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****    |  |                ^*****     |  ||| |||  ||  | || | |     ^***** |    | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |                  | |      |  ||| ||*****  | || | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |                  | |      |  |*********   | || | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |                  ***      |  |            ***| | |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                           ****               | ***         ****                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                            ***                                         

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |              | |       |    |     | |||  | |  ||| |||| | |     |   ^***    | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |              | |       |    |     **^*|  | |  ||| |||| | |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |              | |       |    |     |  ||  | |  ||| |||^** |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****              | |       ^*****     |  ||  | |  ||| |||  | |     ^***** |    | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    | |                  |  ||  | *****| |||  | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | |                  |  |**** ****|****|  | |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..                    ***                  |  |         |  ***  | |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****         |    |  ***         ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |     | |     | | |      ||  ||     | |||  | || ||| |||||| |   | ||  ^***    | |         |  |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  | |     | |     | | |      ||  ||     **^*|  | || ||| |||||| |   | ||  || |    | |         |  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |     | |     | | |      ||  ||     |  ||  | || ||| |||^** |   | ||  || |    | |         |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     | |     | | |      ^*****     |  ||  | || ||| ||| |  |   | ^***** |    | |         |  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |     | |     | | |       |  |      |  ||  | ****** ||| |  |   |  |  |  |    | |         |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |     | |     | | |       |  |      |  |**** *********| |  |   ****  |  |    | |         |  |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |     | |     *** |       |  |      |  |         |  | | |  |         |  |    | |         |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..   ***     | |       | |       |  |      |  |         |  *** |  |         |  |    ***         |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..           ***       ***       ****      ****         |    | ****         ****                ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |       | || |           |    |     | ||     || ||| |||||| |     |   ^***    | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |       | || |           |    |     **^*     || ||| |||||| |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |       | || |           |    |              || ||| |||^** |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****       | || |           ^*****              || ||| ||| |  |     ^***** |    | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             | || |                               ****** ||| |  |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | || |                               *********| |  |         ****    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..             ******                                   |  *** |  |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                                      |    | ****         ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |  | |                   |    |     | ||     |  ||| |||||| |     |   ^***    | |              | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |  | |                   |    |     **^*     |  ||| |||||| |     |   || |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |  | |                   |    |     |  |     |  ||| |||^** |     |   || |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****  | |                   ^*****     |  |     |  ||| ||| |  |     ^***** |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |                              |  |     *****| ||| |  |         |  |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |                              |  |     ****|****| |  |         ****    | |              | |  
search RasMol script viewer Motif-ligand binding stats  nest ..        ***                              |  |         |  *** |  |         |  |    ***              | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****         |    | ****         ****                     ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |||| |                    |    |     | |||| |||  ||  | |||| |     |   ^***    | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|   |||| |                    |    |     **^*|| |||  ||  | |||| |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |||| |                    |    |     |  ||| |||  ||  | |^** |     |   || |    | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|| |                    ^*****     |  ||| |||  ||  | | |  |     ^***** |    | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | || |                               |  ||| ||*****  | | |  |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | || |                               |  |*********   | | |  |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..    ***| |                               |  |            *** |  |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..       ***                               ****                ****         ****                          

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |  | || |                | | ||     | ||     |  ||| |||||| |     |   ^***    | |           | |     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |  | || |                | | ||     **^*     |  ||| |||||| |     |   || |    | |           | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |  | || |                | | ||     |  |     |  ||| |||^** |     |   || |    | |           | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****  | || |                ^*****     |  |     |  ||| ||| |  |     ^***** |    | |           | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | || |                  | |      |  |     *****| ||| |  |         |  |    | |           | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | || |                  | |      |  |     ****|****| |  |         ****    | |           | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        ******                  | |      |  |         |  | | |  |         |  |    | |           | |     
search RasMol script viewer Motif-ligand binding stats  nest ..                                ***      |  |         |  *** |  |         |  |    ***           ***     
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****         |    | ****         ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |               | |      |    |     | ||    || |||  | |||| |     |   ^***    | ||  |               
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    |               | |      |    |     **^*    || |||  | |||| |     |   || |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |               | |      |    |     |  |    || |||  | |^** |     |   || |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****               | |      ^*****     |  |    || |||  | | |  |     ^***** |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | |                 |  |    ******  | | |  |         |  |    | ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     | |                 |  |    *****   | | |  |         ****    | |****               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ***                 |  |            | | |  |         |  |    | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..                                         |  |            *** |  |         |  |    ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                         ****                ****         ****                          

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-LIKE PROTEIN SMT3B
member of: CATH:search3.10.20.90GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10562/searchPTHR10562_SF10PFAM:searchPF11976PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP61956
sec str:  ..........................eeeeee.....eeeeee.....hhhhhhhhhhhh........eee..ee...............eeeee...........
sequence :  ..GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    | |||||         | |      |    |     | ||     || ||| ||||||||     |   ^***    | |              | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    | |||||         | |      |    |     **^*     || ||| ||||||||     |   || |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    | |||||         | |      |    |     |  |     || ||| |||^**||     |   || |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^***** |||||         | |      ^*****     |  |     || ||| ||||| ||     ^***** |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |||||         | |                 |  |     ****** |||*****         |  |    | |              | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |||||         | |                 ****     *********|****|         ****    | |              | |  
search RasMol script viewer Motif-ligand binding stats  nest ..     *******         | |                 |  |         |  *** |  |         |  |    ***              | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                     ***                 ****         |    | ****         ****                     ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ******                                            

   New search    1wz0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML