triangle PDBeMotif: 1wfn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification cell adhesion    | release date: Wed, May 26, 2004
Title the fourth fn3 domain of human sidekick-2
Authors F.HAYASHI, GENOMICS/PROTEOMICS INITIATIVE (RSGI), RIKEN STRUCTURAL, S.YOKOYAMA, T.NAGASHIMA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTG
LTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |  |||  |  | ^*** |     |^***                    | |  |    |    |    || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |  |||  |  |   |  |     |  |                     ^**  |    |    |    || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |  |||  ^***   |  |     |  |                          |    |    |    || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****| | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                           | |  **          |  |     |  |                                          | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                           | |              |  |     |  |                                          *** 
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      | |||       |  |    | | |  |   | |  |||  |  | ^*** |     |^***       |  |         | |  |    |    |  | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      | |||       |  |    ^** |  |   | |  |||  |  |   |  |     |  |        |  |         ^**  |    |    |  | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***|       ^***        ^***   | |  |||  ^***   |  |     |  |        |  |              |    |    |  | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****        | |                          | ^*****         |  |     |  |        |  |              ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |                          | |  **          |  |     |  |        |  |                           | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |                          | |              |  |     |  |        ****                           | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | |                          | |              |  |     |  |                                       ***    
search RasMol script viewer Motif-ligand binding stats  nest ..              | |                          ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..              ***                                           ****     ****                                              

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |      |  |        |  |    | | |  |   | |    |  |  | ^***       |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |      |  |        |  |    ^** |  |   | |    |  |  |            |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  | |      ^***        ^***        ^***   | |    |  ^***            |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****                  |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  nest ..   ***                                     ***                       |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                     ****                                              

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      | |||       |  |    | | |  |  | ||  |||  |  | ^***||     |^***                    | |  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      | |||       |  |    ^** |  |  | ||  |||  |  |  || ||     |  |                     ^**  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***|       ^***        ^***  | ||  |||  ^***  || ||     |  |                          |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****        | |                         | |^*****        || ||     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |                         | |   **         || ||     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |                         | |              *****     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | |                         | |               |  |     |  |                                      ***     
search RasMol script viewer Motif-ligand binding stats  nest ..              | |                         ***               |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..              ***                                           ****     ****                                              

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    | | || |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    | | || |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    | | || |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^***** |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                           | |              |  |     |  |                                      | |***  
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                      ***     

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^***       |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |            |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***            |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****                  |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***                       |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                     ****                                              

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      | |||       |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      | |||       |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***|       ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****        | |                          | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  nest ..              | |                          ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..              ***                                           ****     ****                                              

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |  |||  |  | ^***       |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |  |||  |  |            |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |  |||  ^***            |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****                  |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                           | |  **                   |  |                                              
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***                       |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                     ****                                              

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      | |||       |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      | |||       |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***|       ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****        | |                          | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | |                          | |              |  |     |  |                                      ***     
search RasMol script viewer Motif-ligand binding stats  nest ..              | |                          ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..              ***                                           ****     ****                                              

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |  |||  |  | ^*** |     |^***                    | |  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |  |||  |  |   |  |     |  |                     ^**  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |  |||  ^***   |  |     |  |                          |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                           | |  **          |  |     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                      ***     

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    || |   |  |        |  |    | | |  |   | |  |||  |  | ^*** |     |^***                    | |  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    || |   |  |        |  |    ^** |  |   | |  |||  |  |   |  |     |  |                     ^**  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    || |   ^***        ^***        ^***   | |  |||  ^***   |  |     |  |                          |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****| |                                  | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                                  | |  **          |  |     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                  | |              ****     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                  | |              |  |     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                      ***     

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  | |  | | |  |   | |  |||  |  | ^*** |     |^***                    | |  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  | |  ^** |  |   | |  |||  |  |   |  |     |  |                     ^**  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^*** |  |   ^***   | |  |||  ^***   |  |     |  |                          |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                       |  |          | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..                             |  |          | |  **          |  |     |  |                                      | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             |  |          | |              |  |     |  |                                      ***     
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |          ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                           ****     ****                                              

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      | |||       |  |    | | |  |   | |  |||  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      | |||       |  |    ^** |  |   | |  |||  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***|       ^***        ^***   | |  |||  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****        | |                          | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |                          | |  **          |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |                          | |              ****     |  |                                              
search RasMol script viewer Motif-ligand binding stats  nest ..              | |                          ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..              ***                                           ****     ****                                              

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    | | ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                           | |              |  |     |  |                                      ***     
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                           | |              ****     |  |                                              
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                           | |              ****     |  |                                              
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SIDEKICK 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR10489/searchPTHR10489_SF37PFAM:searchPF00041PROSITE PROFILES:searchPS50853, SMART:searchSM00060SUPERFAMILY:searchSSF49265UniProt:searchQ58EX2
sec str:  ..........................eee.....eeeee............eeeeeeee..hhhhh..eee.....eeeee......eeeeeeeee....eeeeeeeeee...........
sequence :  ..GSSGSSGPQLVRTHEDVPGPVGHLSFSEILDTSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPSGPSSG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |  |        |  |    | | |  |   | |    |  |  | ^*** |     |^***                    | |  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |  |        |  |    ^** |  |   | |    |  |  |   |  |     |  |                     ^**  |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |      ^***        ^***        ^***   | |    |  ^***   |  |     |  |                          |    |    |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****                                     | ^*****         |  |     |  |                          ^*****    ^*****    
search RasMol script viewer Motif-ligand binding stats  nest ..                                           ***              |  |     |  |                                              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                            ****     ****                                              

   New search    1wfn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML