triangle PDBeMotif: 1w98  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.37
Classification transferase    | release date: Thu, Oct 7, 2004
Title the structural basis of cdk2 activation by cyclin e
Authors A.COOK, E.D.LOWE, E.DUBININA, L.N.JOHNSON, R.HONDA, V.SKAMNAKI
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Modified residues:  search TPO TPO binding statistics TPO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
THEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPS
FPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR
Chain B sequence:
IIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDR
YMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQ
VAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFA
MVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CELL DIVISION PROTEIN KINASE 2
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24056/searchPTHR24056_SF168PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP24941
sec str:  ......eeeeeeeeee..eeeeeeee.....eeeeeeee.hhh....hhhhhhhhhhhhh........eeeeeee..eeeeeee...eehhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.............hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh........hhhhh.............hhhhhh...hhhhhhhhhhhh........hhhhhhhhhhhh..........
sequence :  ..SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |  ||||    |          | |    |   | || || |  ||   |      |  |   ||   |  |              |   |                   |    ||||| | | || || || | |    ||| |  |            ||  |     | |    | ||  | |   ||  | |      |  |   |   |  |  |    ||||| |||  |           |  |         |  | || **^* | |  ||  |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |  ||||    |          | |    |   | || || |  ||   |      |  |   ||   |  |              |   |                   |    |^**| | | || || || | |    ||| |  |            ||  |     | |    | ||  | |   ||  ^**      |  |   |   |  |  |    ||||| |||  |           |  |         |  | || || ^** |  ||  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  ||||    |          | |    |   | ^***| |  ||   |      |  |   ||   |  |              |   |                   |    | ||| | | || || || | |    ||| |  |            ||  |     | |    ^***  | |   ||  | |      ^***   |   |  ^***    |||^***||  |           |  |         |  | || ||     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |  ||******^          | |    |   |  |  | |  ||   |      |  |   ||   |  |              |   |                   |    | ||| | | || || || | |    ||| |  |            ||  |     | |      |   | |   ||  | |             |   |          |||||  ||  |           |  |         |  | || ||     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |  || |               | |    |   |  |  ^*****|   |      |  |   ||   |  |              |   |                   ^***** ||| | | || || || | |    ||^*****            ||  |     | |      |   | ^*****  | |             |   |          |||||  ||  |           |  |         |  | || ||     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP .. |  |  || ************************   |  |    |  ||   |      |  |   ||   |  |              |   |                        | ||| | | || || || | |    ||| |               ||  |     | |      |   |     |   | |             |   |          |||||  ||  |           |  |         |  | || ||     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST .. |  |  ||                 | |        |  |    |  ||   |      |  |   ||   |  |              |   |                        | ||****^********| | |    ||| |               ||  |     | |      |   |     |   | |             |   |          |||||  ||  |           |  |         |  | || ||     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  ||                 | |        |  |    *****   |      |  |   ||   |  |              |   |                        | ||| | | || ||  | | |    ||| |               ||  |     | |      |   |     |   | |             |   |          |||||  ||  |           |  |         |  | *****     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  ||                 | |        |  |    |  ||   |      |  |   ||   |  |              |   |                        | ||| | | || ||  *** |    *** |               ||  |     | |      |   |     |   | |             |   |          |||||  ||  |           |  |         |  | || ||     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |  **                 | |        |  |    |  ||   |      |  |   **   |  |              |   |                        | ||| | | || ||    | |    ||| |               ||  |     | |      |   |     |   | |             |   |          |||||  ||  |           |  |         |  | || ||     |  ||  |          
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |                     | |        ****    ****|   |      |  |        |  |              |   |                        ****| | | || ||    | |    ||| |               ||  |     | |      |   |     |   | |             |   |          ********|  |           |  |         |  | ****|     |  |****          
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                     ***        |  |        |   |      |  |        |  |              |   |                          *** *** || ||    ***    *** |               ||  |     ***      |   |     |   ***             |   |          *** |  ||  |           |  |         |  | ||  |     |  |              
search RasMol script viewer Motif-ligand binding stats  niche .. ****                                ****        |   |      ****        ****              |   |                                | |****            ****               |****              |   |     |   |               |   |           ***********           ****         **********     ****              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                                    *****                                | |  |                                |                  *****     *****               *****                                                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                               * *  *                                *                                                                                                                                    

chain B : G1/S-SPECIFIC CYCLIN E1
member of: CATH:search1.10.472.10GENE3D:searchG3DSA_1.10.472.10PANTHER:searchPTHR10177/searchPTHR10177_SF71PFAM:searchPF00134/searchPF02984PROSITE PATTERNS:searchPS00292, SMART:searchSM00385SUPERFAMILY:searchSSF47954UniProt:searchP24864
sec str:  ...........hhhhhhhhhhhhh.......hhhhhh...hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh....hhhhhhhh.....hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhh.....hhhhhhh.
sequence :  ..SPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDK
seq num:  ..88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                    |  ||      |  |  |    |          || ||||  |||        || ||         ||  ||     |  |    |  ||   | | || |||       || |||                |  || | |  |                 |  | ||  || |||  | || ||| |  |  | |                       ^**   |  ||  ||  | ^**|       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                    |  ||      |  |  |    |          || ||||  |||        || ||         ||  ||     |  |    |  ||   | | |^***|       || |||                |  || | |  |                 |  | ||  || |||  | || |^***  |  | |                             |  ||  ||  | ^***       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                    |  ||      |  |  |    |          || |*******^        || ||         ||  ||     |  |    |  ||   | | || | |       || |||                |  || | |  |                 |  | ||  || |||  | || ||| |  |  | |                             |  ||  ||  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                    |  ||      |  |  |    |          || ||||  ||         || ||         ||  ||     |  |    |  ||   | ^***** |       || |||                |  || | |  |                 |  | ||  || ^***** || ||| |  |  | |                             |  ||  ||  |            
search RasMol script viewer Motif-ligand binding stats  CYCLINS ..                    |  ||      |  |  |    ********************************| ||         ||  ||     |  |    |  ||   | | ||   |       || |||                |  || | |  |                 |  | ||  ||  ||  | || ||| |  |  | |                             |  ||  ||  |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    *****      |  |  |               || |||*****         || ||         ||  ||     |  |    *****   | | ||   |       || |||                |  || | |  |                 |  | ||  |*****  | || ||| |  |  | |                             |  |*****  |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                    |  |       |  |  |               || ||||  |          || ||         ||  ||     |  |    |  |    | | ||   |       || |||                |  || | |  |                 |  ***|  ||  |   | || ||| |  |  | |                             |  ||  ||  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    ****       *******               |****|****          *****         ||  ||     |  |    ****    | | ||   |       |****|                |  || | |  |                 |  |  |  |****   | *****| |  |  | |                             |  |****|  |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                  |  |               |  | |               |  |         ||  ||     |  |            | | ||   |       |  | |                |  || ***  |                 |  |  |  |   |   | |   || |  |  ***                             |  |    |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..                                  |  |               |  ***               |  |         ||  ||     |  |            *****|   |       |  ***                |  || | |  |                 |  |  |  |   |   | |   || |  |  | |                             |  |    |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                                  ****               |    |               ****         ||  ||     ****                 |   |       |    |                ******* ****                 ****  ****   |   | |   || |  ******                             ****    ****            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                     ******                            ||  ||                          |   |       ******                                                          |   | |   || |                                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                       ||  ||                          *****                                                                       |   | |   || |                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                       ******                                                                                                      ***** *****| |                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                              ***                                                             

   New search    1w98:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors