triangle PDBeMotif: 1w76  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.1.7
Classification hydrolase    | release date: Mon, Aug 30, 2004
Title orthorhombic form of torpedo californica acetylcholinesterase (ache) complexed with bis-acting galanthamine derivative
Authors B.BADET, C.GUILLOU, C.THAL, D.GUENARD, H.M.GREENBLATT, I.SILMAN, J.L.SUSSMAN
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search GNT GNT binding statistics GNT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchACHEFISH/searchCHOLNESTRASEPROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP04058
JMol viewer RasMol script viewer  GNT 1538A  ..                                                                                *                                 ** *                                                                             **                                                                                   ..GNT ..*                                        *                                                                                                            *                                             ..GNT ..                                              
JMol viewer RasMol script viewer  NAG 1537A  ..                                                                                |                                 || |                                                                             ||                                                                                   ..NAG ..|                                        |                                                                                    *                       |                                             ..NAG ..                                              
JMol viewer RasMol script viewer  NAG 1536A  ..                                                       * *                      |                                 || |                                                                             ||                                                                                   ..NAG ..|                                        |                                                                                    |                       |                                             ..NAG ..                                              
sec str:  ....eeeee..eeeeeeeee....eeeeeeeee......................eeee..................hhhhhhh..........eeeeeee......eeeeeeee...............hhhhhhhh..eeeeee....................hhhhhhhhhhhhhhhh.........eeeeeeehhhhhhhhhhhh........eeeeeee...........hhhhhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhh........ .................hhhhhhh......eeeeeee....hhhhhhh.............hhhhhhhhhhhh....hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee...................hhhhhh...........hhhhhhhhhhhhhhhhhhhh......... ..............eeee....eeeee...hhhhhhhhhhhhhhhhhh
sequence :  ..SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLP... ..FSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPNEP... ..SKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       ... ..290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   ... ..490       500       510       520       530   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | | |               | ||   || || || |         |  ^***            |  ||  |  |  |  |||| |     || |            ||| |||| || || |     | |     | |   |  |    | |   | |              |  | || |||     |||| |  |   |  || |         |  |  |  |  |  |     || |||| ||  |   || ||     |  ||  | ..PS00001..       ||||  |  ||   | |             |     |  |  ||  |||| |  |   |   ||  ||   |   ||  || ||  |                        |   |   ^***   | | |  | | |  |  |||| || |||  |  |^*** |   | |  |   |   | | |  ..PS00001..      | || |    | |        | |           ||^**
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | ^**               | ||   || || || |         |    |             |  ||  |  |  |  |||| |     |^**            ||| |||| || || |     | |     ^**   |  |    | |   | |              |  | || |||     |||| |  |   |  || |         |  |  |  |  |  |     || |||| ||  |   || ||     |  ||  | ..PS00005..       ||||  |  ||   | |             |     |  |  ||  |||| |  |   |   ||  ||   |   ||  || ||  |                        |   |          | | |  | | |  |  |||| || |||  |  | ||  |   ^**  |   |   | | |  ..PS00005..      ^**| |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  | |                 | ||   || || || |         |    |             |  |^***  |  |  |||| |     |               ||| |||^*** || |     | |           |  |    | |   | |              |  | || |||     |||| |  |   |  || |         |  |  |  ^***  |     || |||| |^***   || ||     |  ||  | ..PS00006..       ||||  ^***|   | |             |     |  |  ||  |||| ^***   |   ||  ||   |   ||  || ||  |                        |   |          | | |  | | |  |  |||| || |||  |  | |^***        |   |   | | |  ..PS00006..      ^*** |    | |        | |           ||  ^
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |  | |                 | ||   || || || |         |    |             |  |   |  |  ********^     |               ||| |||  || || |     | |           |  |    | |   | |              |  | || |||     |||| |  |   |  || |         |  |  |     |  |     || |||| ||      || ||     |  ||  | ..PS00007..       ||||      |   | |             |     |  |  ||  ||||        |   ||  ||   |   ||  || ||  |                        |   |          | | |  | | |  |  |||| || |||  |  | |            |   |   | | |  ..PS00007..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |                 | ^*****| || || |         ^*****             |  |   |  |     |||| |     |               ^*****|  || || |     | |           |  |    | |   | |              |  | || |||     |||^*****   |  || |         |  |  |     |  |     || |||| ||      || ||     |  ||  | ..PS00008..       ||||      |   | |             |     |  |  ||  ||||        ^*****  ||   |   ||  || ||  |                        |   |          | | |  | | |  ^*****| || |||  |  | |            |   |   | | |  ..PS00008..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|  |  | |                 |  |    | || || |                            |  |   |  |     |||| |     |               ||| | |  || || |     | |           |  |    | |   | |              |  | || |||     |||  |      |  || |         |  |  |     ^***     || |||| ||      || ||     |  ||  | ..PS00009..       ||||      |   | |             |     |  |  ||  ||||        |   ||  ||   |   ||  || ||  |                        |   |          | | |  | | |  |  || | || |||  |  | |            |   |   | | |  ..PS00009..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 ..|  |  | |                 |  |    | || || |                            |  |   |  |     |||| |     |               ||| | |  || || |     | |           |  |    | |   | |              |  *************^**  |      |  || |         |  |  |              || |||| ||      || ||     |  ||  | ..PS00122..       ||||      |   | |             |     |  |  ||  ||||        |   ||  ||   |   ||  || ||  |                        |   |          | | |  | | |  |  || | || |||  |  | |            |   |   | | |  ..PS00122..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 ..|  |  | |                 |  |    | || || |                            |  |   |  |     |**^********               ||| | |  || || |     | |           |  |    | |   | |              |  | || |||     ||   |      |  || |         |  |  |              || |||| ||      || ||     |  ||  | ..PS00941..       ||||      |   | |             |     |  |  ||  ||||        |   ||  ||   |   ||  || ||  |                        |   |          | | |  | | |  |  || | || |||  |  | |            |   |   | | |  ..PS00941..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |  | |                 |  |    | || || |                            |  |   |  |     | || |                     ||| | |  || || |     | |           |  |    | |   | |              |  | || |||     ||   |      ***** |         |  |  |              || |||| ||      || ||     |  ||  | ..alphabetamotif..       ||||      |   | |             |     |  |  ||  ||||        |   ||  ||   |   ||  || ||  |                        |   |          | | |  | | |  |  || | || |||  |  | |            |   |   | | |  ..alphabetamotif..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |  | |                 |  |    | || || |                            |  |   |  |     | || |                     ||| | |  || || |     | |           |  |    | |   | |              |  | |*****     ||   |      |  |  |         |  |  |              || |||| ||      || ||     |  ||  | ..asxmotif..       ||||      |   | |             |     |  |  ||  ||||        |   ||  |*****   ||  || ||  |                        |   |          | | |  | | |  |  || | || |||  |  | |            |   |   | | |  ..asxmotif..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |  | |                 |  |    | || || |                            |  |   |  |     | || |                     ||| | |  || |***     | |           |  |    | |   | |              |  | |***|      ||   |      |  |  |         |  |  |              || |||***|      || ||     |  ||  | ..asxturn..       ***|      |   | |             |     |  |  ||  ||||        |   ||  |        ||  |***|  |                        |   |          | | |  | | |  |  || | || |||  |  | |            |   |   | ***  ..asxturn..         | |    | |        | |           ||  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |  | |                 |  |    | ****| |                            |  |   ****     | || |                     ||| | |  ****|       | |           |  |    | |   | |              **** |****      ||   |      *******         |  ****              *****||  |      ****|     ****|  | ..betaturn..       ||||      |   | |             |     |  |  ||  ||||        |   ||  |        ||  |   |  |                        |   |          | | |  | | ****  || | |****|  |  | |            |   |   | | |  ..betaturn..         | |    | |        | |           |****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |  | |                 |  |    ***| || |                            |  |   |  |     | |***                     ||| | |  ||  |       | |           |  |    | |   | |                 | |          ||   |                      |  |                    | ||  |       |  |         |  | ..gammaturn..       ||||      |   | |             |     |  |  ||  ||||        |   ||  |        ||  |   |  |                        |   |          | | |  | |       || | |  |||  |  | |            |   |   | | |  ..gammaturn..         | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  nest ..|  |  | |                 |  |       | || |                            |  |   |  |     | |                        ||*** |  ||  |       ***           |  |    | |   ***                 ***          ||   |                      |  |                    ***|  |       |  |         |  | ..nest..       ****      |   ***             |     |  |  ||  |***        |   ||  |        ||  |   |  |                        |   |          | | |  | |       |*** |  ***  |  ***            |   |   *** |  ..nest..         ***    | |        ***           |   |
search RasMol script viewer Motif-ligand binding stats  niche ..****  | |                 ****       ******                            ****   ****     | |                        ||    ********                     ****    | |                                    ||   |                      ****                       ****       ****         **** ..niche..                 |   |               |     *********** |         |   |****        |****   ****                        |   |          *** ******       |    |   |****                 |   |   | ***  ..niche..                ***                      |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..      | |                                                                              | |                        ||                                         | |                                    ||   |                                                                              ..schellmannloop..                 |   |               |            |  | |         |   |            |   |                               |   |                           |    ******                    |   |   | |    ..schellmannloop..                                         |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..      | |                                                                              | |                        ||                                         | |                                    |*****                                                                              ..ststaple..                 *****               |            ******         *****            *****                               *****                           |        |                     *****   | |    ..ststaple..                                         *****
search RasMol script viewer Motif-ligand binding stats  stturn ..      ***                                                                              ***                        ||                                         ***                                    ||                                                                                  ..stturn..                                     |               ***                                                                                              |        |                             ***    ..stturn..                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                  **                                                                                **                                                                                  ..REP00000..                                     *                                                                                                                *        *                                    ..REP00000..                                              

chain B : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchACHEFISH/searchCHOLNESTRASEPROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP04058
JMol viewer RasMol script viewer  GNT 1538B  ..                                                                    *           *                                 *  *                                                                             **                                                                                   ..GNT ..*                                        *                                                                                                            *                                             ..GNT ..                                              
JMol viewer RasMol script viewer  NAG 1537B  ..                                                                    |           |                                 |  |                                                                             ||                                                                                   ..NAG ..|                                        |                                                                                    *                       |                                             ..NAG ..    *                                         
JMol viewer RasMol script viewer  NAG 1536B  ..                                                       * *          |           |                                 |  |                                                                             ||                                                                                   ..NAG ..|                                        |                                                                                    |                       |                                             ..NAG ..    |                                         
sec str:  ....eee......eeeeeee....eeeeeeeeee.eeee.................eee.................hhhhhhhh........eeeeeeee.......eeeeeee................hhhhhhhh..eeeee...............eee..hhhhhhhhhhhhhhhhhh.........eeeeeehhhhhhhhhhhhh.......eeeeee...........hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......... ................hhhhhhhhheee...eeeeeeee.hhhhhhhhh...........hhhhhhhhhhhhh...hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.........hhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh........ ..............eeee.....eee...hhhhhhhhhhhhhhhhhhh
sequence :  ..SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLP... ..FSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPNEP... ..SKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       ... ..290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   ... ..490       500       510       520       530   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||  | | |               | ||   |  || || |         |  ^***            |  ||  |  |  |  |||| |     || |            |||||||| || ||       | |     | | | |||| |  | |   | |              |  | ||  |      ||||||  ||      |  |        |  || || |  |  |     |  | || || ||   || || |  ||   |  | ..PS00001..       ||||  || |||  | |             |     |  |  ||  |||| |  |   ||  ||  |        ||  |   |  |                        |   |   ^***   | | |  | | |  |  |||| || ||| ||| |^*** ||  | |  |   |   | | |  ..PS00001..      | ||||    | |        | |           | ^**
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||  | ^**               | ||   |  || || |         |    |             |  ||  |  |  |  |||| |     |^**            |||||||| || ||       | |     ^** | |||| |  | |   | |              |  | ||  |      ||||||  ||      |  |        |  || || |  |  |     |  | || || ||   || || |  ||   |  | ..PS00005..       ||||  || |||  | |             |     |  |  ||  |||| |  |   ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  |||| || ||| ||| ||||  ||  ^**  |   |   | | |  ..PS00005..      ^**|||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||  | |                 | ||   |  || || |         |    |             |  |^***  |  |  |||| |     |               |||||||^*** ||       | |         | |||| |  | |   | |              |  | ||  |      ||||||  ||      |  |        |  || || ^***  |     |  | || |^***   || || |  ||   |  | ..PS00006..       ||||  ^***||  | |             |     |  |  ||  |||| ^***   ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  |||| || ||| ||| |||^***|       |   |   | | |  ..PS00006..      ^***||    | |        | |           |   ^
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| ||  | |                 | ||   |  || || |         |    |             |  |   |  |  ********^     |               |||||||  || ||       | |         | |||| |  | |   | |              |  | ||  |      ||||||  ||      |  |        |  || ||    |  |     |  | || || |    || || |  ||   |  | ..PS00007..       ||||   |  ||  | |             |     |  |  ||  ||||        ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  |||| || ||| ||| ||||   |       |   |   | | |  ..PS00007..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||  | |                 | ^*****  || || |         ^*****             |  |   |  |     ||||       |               ^*****|  || ||       | |         | |||| |  | |   | |              |  | ||  |      |||^*****|      |  |        |  || ||    |  |     |  | || || |    || || |  ||   |  | ..PS00008..       ||||   |  ||  | |             |     |  |  ||  ||||        ^*****  |        ||  |   |  |                        |   |          | | |  | | |  ^*****| || ||| ||| ||||   |       |   |   | | |  ..PS00008..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..| ||  | |                 |  |      || || |                            |  |   |  |     ||||       |               ||||| |  || ||       | |         | |||| |  | |   | |              |  | ||  |      ||||||  ||      |  |        |  || ||    ^***     |  | || || |    || || |  ||   |  | ..PS00009..       ||||   |  ||  | |             |     |  |  ||  ||||        ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  || | || ||| ||| ||||   |       |   |   | | |  ..PS00009..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 ..| ||  | |                 |  |      || || |                            |  |   |  |     ||||       |               ||||| |  || ||       | |         | |||| |  | |   | |              |  *************^**|||  ||      |  |        |  || ||             |  | || || |    || || |  ||   |  | ..PS00122..       ||||   |  ||  | |             |     |  |  ||  ||||        ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  || | || ||| ||| ||||   |       |   |   | | |  ..PS00122..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 ..| ||  | |                 |  |      || || |                            |  |   |  |     |**^********               ||||| |  || ||       | |         | |||| |  | |   | |              |  | ||  |      || |||  ||      |  |        |  || ||             |  | || || |    || || |  ||   |  | ..PS00941..       ||||   |  ||  | |             |     |  |  ||  ||||        ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  || | || ||| ||| ||||   |       |   |   | | |  ..PS00941..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| ||  | |                 |  |      || || |                            |  |   |  |     | |                        ||||| |  || ||       | |         *****| |  | |   | |              |  | ||  |      **********      |  |        |  || ||             |  | || || |    ***** *****   |  | ..alphabetamotif..       ||||   |  ||  | |             |     |  |  ||  ||||        ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  || | || ||| ||| ||||   |       |   |   | | |  ..alphabetamotif..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  asxturn ..| ||  | |                 |  |      || || |                            |  |   |  |     | |                        ||||| |  || ||       | |         | || | |  | |   | |              |  | ||  |      || | |  |       |  |        |  || ||             |  | |***| |    || || |  |    |  | ..asxturn..       ***|   |  ||  | |             |     |  |  ||  ||||        ||  ||  |        ||  |   |  |                        |   |          | | |  | | |  |  || | || ||| ||| ||||   |       |   |   | ***  ..asxturn..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  betaturn ..| ||  | |                 |  |      *******                            |  |   |  |     | |                        ****| |  ****|       | |         **** | **** |   | |              **** |****      **** ****       |  |        |  ****|             **** |   | |    ****| ****    |  | ..betaturn..       ||||   |  ||  | |             |     |  |  ||  ||||        |********        ||  |   |  |                        |   |          | | |  | | ****  || | |*******|****||   |       |   |   | | |  ..betaturn..      |  |||    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  nest ..| ||  | |                 |  |       | || |                            |  |   |  |     | |                        ||*** |  ||  |       ***           |  | |  | |   ***                 ***          ||   |          |  |        |  ||  |                ***   | |     |  |         |  | ..nest..       ****   |  ||  ***             |     |  |  ||  |***        |   ||  |        ||  |   |  |                        |   |          | | |  | |       |*** |  ***  |  ***|   |       |   |   *** |  ..nest..      |  ***    | |        ***           |   |
search RasMol script viewer Motif-ligand binding stats  niche ..****  | |                 ****       ******                            ****   ****     | |                        ||    ********                     **** **** |                                    ||   |          ****        ********                      | |     ****         **** ..niche..              |  ||  |               |     *********** |         |   |****        |****   ****                        |   |          *** ******       |    |   |****     |   |       |   |   | ***  ..niche..      |   |     ***                      |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..| |   | |                                                                              | |                        ||                                         | |                                    ||   |                                                    | |                       ..schellmannloop..              |  ||  |               |            |    |         |   |            |   |                               |   |                           |    ******        |   |       |   |   | |    ..schellmannloop..      |   |                              |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..| |   | |                                                                              | |                        ||                                         | |                                    ||   |                                                    | |                       ..stmotif..              *****  |               |            |    |         |   |            |   |                               |   |                           |        |         *****       |   |   | |    ..stmotif..      *****                              |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..| |   | |                                                                              | |                        ||                                         | |                                    |*****                                                    | |                       ..ststaple..                 *****               |            ******         *****            *****                               *****                           |        |                     ********* |    ..ststaple..                                         *****
search RasMol script viewer Motif-ligand binding stats  stturn ..***   ***                                                                              ***                        ||                                         ***                                    ||                                                        ***                       ..stturn..                                     |                                                                                                                |        |                             ***    ..stturn..                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                  **                                                                                **                                                                                  ..REP00000..                                     *                                                                                                                *        *                                    ..REP00000..                                              

   New search    1w76:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors