triangle PDBeMotif: 1vzj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.1.7
Classification hydrolase    | release date: Thu, May 20, 2004
Title structure of the tetramerization domain of acetylcholinesterase: four-fold interaction of a www motif with a left-handed polyproline helix
Authors C.GARBAY, H.DVIR, I.SILMAN, J.L.SUSSMAN, J.MASSOULIE, M.HAREL, M.VIDAL, S.BON, W.-Q.LIU
Method X-RAY DIFFRACTION (resolution: 2.35Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F,G,H sequence:
DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL
Chains I,J sequence:
LLTPPPPPLFPPPFF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..LDEAERQWKAEFHRWSSYMVHWKNQF
seq num:  ..3         13        23    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***    |  ||  |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****  *********   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****   ********    

chain B : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DTLDEAERQWKAEFHRWSSYMVHWKNQFDHY
seq num:  ..1         11        21         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|^***                          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..*****                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..****                           

chain C : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYS
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|^*** ||                       ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |*****                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..***|  |                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****                         

chain D : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYS
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***        |  || ||          ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             ********           
search RasMol script viewer Motif-ligand binding stats  betaturn ..             *******            

chain I : ACETYLCHOLINESTERASE COLLAGENIC TAIL PEPTIDE
member of: UniProt:searchQ9Y215
sec str:  .................
sequence :  ..LLTPPPPPLFPPPFF
seq num:  ..1         11   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  .......hhhhhhhhhhhhhhhhhhhhhh
sequence :  ..TLDEAERQWKAEFHRWSSYMVHWKNQF
seq num:  ..2         12        22     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***    |  ||  |  ||  |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****  *****  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****   ****   **** 

chain F : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQ
seq num:  ..1         11        21        31  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***                  || |||  ^**
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       ******     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       *****      

chain G : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQ
seq num:  ..1         11        21        31  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|^*** ||  |  ||            |  |^**
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |*****  *****            ***** |
search RasMol script viewer Motif-ligand binding stats  asxturn ..***|  |   |  |             |  |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****   ****             *******

chain H : ACETYLCHOLINESTERASE
member of: PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF08674PRODOM:searchPD415333UniProt:searchP22303
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYS
seq num:  ..1         11        21          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***         |   |            ^
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****             

chain J : ACETYLCHOLINESTERASE COLLAGENIC TAIL PEPTIDE
member of: UniProt:searchQ9Y215
sec str:  .................
sequence :  ..LLTPPPPPLFPPPFF
seq num:  ..1         11   

   New search    1vzj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors