triangle PDBeMotif: 1vdg  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system    | release date: Mon, Mar 22, 2004
Title crystal structure of lir1.01, one of the alleles of lir1
Authors D.KOHDA, K.AMANO, K.KUROKI, K.MAENAKA, K.TOKUNAGA, L.RASUBALA, M.SHIROISHI, N.TSUCHIYA
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSD
TAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFS
VGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LEUKOCYTE IMMUNOGLOBULIN-LIKE RECEPTOR SUBFAMILYB MEMBER 1;
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11738/searchPTHR11738_SF89PFAM:searchPF13895/searchPF13927PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8NHL6
sec str:  ........eeeee...eee....eeeeee.......eeeee......hhhhhhhhhhhh.eeee...hhhhheeeeeee...........eeeeee......eeeee...eee....eeeeee......eeeeee....eeee........eeeeee.........eeeeeee......ee......ee.eee
sequence :  ..GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYG..GRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKE..QCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVL
seq num:  ..1         11        21        31        41        51        61        71      ..83        93        103       113       123       133 ..143       153       163       173       183       193  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            | | ||||  ^**  |    |     |  |   || ||    | |||      |||||       |..|             | |         | | |  |                    ..          |^** |      | ^**        | ||  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | | ||||   |   |    |     |  |   || ||    | |||      |||||       |..|             | |         | | |  |                    ..          |    |      |  |         | |^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            ^*****^*****   ^*****     |  |   || ||    | |||      |||||       ^..*             | |         | | |  |                    ..          ^*****      |  |         | ||  |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | | |  |                  |  |   || ||    | |||      |||||        ..              | |         | | |  |                    ..                      |  |         ***|  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | ****                  |  |   ****|    ****|      ****|        ..              | |         | | ****                    ..                      |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  nest ..            | | |  |                  |  |    |  |      ***      ||| |        ..              ***         | |                         ..                      |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..            *** ****                  ****    ****               |****        ..                          ***                         ..                      ****            ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                 *****        ..                                                      ..                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***          ..                                                      ..                                                       

chain B : LEUKOCYTE IMMUNOGLOBULIN-LIKE RECEPTOR SUBFAMILYB MEMBER 1;
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11738/searchPTHR11738_SF89PFAM:searchPF13895/searchPF13927PROSITE PROFILES:searchPS50835, SMART:searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchQ8NHL6
sec str:  ........eeeee...eee....eeeeee.......eeeee....hhhhhhhhhhhhh..eeee...hhhhheeeeeee..............eeeeee......eeeee...eee....eeeeee......eeeeee....eeee........eeeeee......... ....eeeeeee..............ee.eee
sequence :  ..GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSD..AGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKE..QCLNSQP..RGSSRAIFSVGPVSPS... ..RWWYRCYAYDSNSPYEWSLPSDLLELLVL
seq num:  ..1         11        21        31        41        51        61        71        ..82        92        102       112       122       132  ..143    ..152       162   ... ..169       179       189      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            |   ||||  ^**  |    |     |  |  | || |   || |||      |||||       |  .. |             | |         | | |  |                    ..       .. |^** |        ^..PS00005..*        | ||  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            |   ||||   |   |    |     |  |  | || |   || |||      |||||       |  .. |             | |         | | |  |                    ..       .. |    |         ..PS00006..         | |^***             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            ^*****^*****   ^*****     |  |  | || |   || |||      |||||       ^**..**             | |         | | |  |                    ..       .. ^*****         ..PS00008..         | ||  |             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  |                  |  |  | || |   *****|      |||||          ..               | |         | | |  |                    ..       ..                ..alphabetamotif..         | ||  |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |                  |  |  | || |   || |||      |||||          ..               | |         | | |  |                    ..       ..                ..asxturn..         ***|  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****                  |  |  **** |   *****|      ****|          ..               | |         | | ****                    ..       ..                ..betaturn..            |  |             
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |                  |  |    |  |      ***      ||| |          ..               ***         | | |  |                    ..       ..                ..nest..            |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..                ****                  ****    ****               |****          ..                           *** ****                    ..       ..                ..niche..            ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                 *****          ..                                                       ..       ..                ..stmotif..                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***            ..                                                       ..       ..                ..stturn..                             

   New search    1vdg:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors