triangle PDBeMotif: 1v2j  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.4
Classification hydrolase    | release date: Fri, Oct 17, 2003
Title benzamidine in complex with bovine trypsin variant x(ssri) bt.c1
Authors D.RAUH, G.KLEBE, M.T.STUBBS
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search CA CA binding statistics CA   search BEN BEN binding statistics BEN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain T sequence:
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSRIITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain T : TRYPSIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24264PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00760
JMol viewer RasMol script viewer  BEN 1T  ..                                                                                                                                                                          ****  *             * *  **      *                   
JMol viewer RasMol script viewer  CA 480T  ..                                                   *    *    *                                                                                                            ||||  |             | |  ||      |                   
JMol viewer RasMol script viewer  SO4 600T  ..                                       *           |    |    |                                                                                                            |||** *             | |  ||      |                   
sec str:  ......ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhh.
sequence :  ..IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSRIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
seq num:  ..16        26        38        48        58        69        79        89        99        109       119       130       141       151       161       171       181       189       199       213       223       233          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |    | |||  |           |   |||| || ||||           | ||          ||   |  || ||||              | ||                   | || | |  | |||            ^**  ^**||| ||    |  | |||||||| |  | ^**       | |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    | |||  |           |   |||| || ||||           | ||          ||   |  || ||||              | ||                   | || | |  ^***|                 |  ||| ||    |  | |||||||| |  |           | |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** |||  |           ^*****|| || ||||           | ||          ||   |  || ||||              | ||                   | ^*****    | |                 |  ||| ||    |  ^*****|||| |  |           ^*****                  |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..       | |||  |               | || ****^*|           | ||          ||   |  || ||||              | ||                   | || |      | |                 |  ||| ||    |  | |||||||| |  |             |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..       | |||  |               | ||  | |  |           | ||          ||   |  || ||||              | ||                   | || |      | |                 |  ||| ||    |  | |******^*****             |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |||  |               ***|  | |  |           ***|          ||   |  |***|||              ***|                   | |***      | |                 |  ||| ||    |  | |||||||| |                |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |||  |               |  |  | |  |           |  |          **   |  |   |||              |  |                   | |         | |                 |  ||| ||    |  | |||||||| |                |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |               |  |  | |  |           |  |               ****   |||              |  |                   | |         | |                 |  |****|    **** |||*******                |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |               |  |  | |  |           |  |               |  |   ***              |  |                   | |         | |                 |  | |  |         |||||*** |                |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..           ****               ****  | ****           ****               ****   |||              ****                   ***         ***                 **** ****         |||||*****                ****                  |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                    |                                          |||                                                                                       ||||||                                          ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                    |                                          ***                                                                                       ||||||                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                    *                                           *                                                                                        ******                                                

   New search    1v2j:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors