triangle PDBeMotif: 1uir  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.5.1.16   2.5.1.22
Classification transferase    | release date: Fri, Jul 18, 2003
Title crystal structure of polyamine aminopropyltransfease from th thermophilus
Authors GENOMICS/PROTEOMICS INITIATIVE (RSGI), M.OHNUMA, N.TANAKA, RIKEN S, T.GANBE, T.KUMASAKA, T.OSHIMA, T.SATO
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR
VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLT
DPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLAS
DAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYKG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYAMINE AMINOPROPYLTRANSFERASE
member of: CATH:search2.30.140.10/search3.40.50.150GENE3D:searchG3DSA_2.30.140.10/searchG3DSA_3.40.50.150HAMAP:searchMF_00198PANTHER:searchPTHR11558/searchPTHR11558_SF26PFAM:searchPF01564PROSITE PATTERNS:searchPS01330, PROSITE PROFILES:searchPS51006, SUPERFAMILY:searchSSF53335UniProt:searchQ5SK28
sec str:  .......eeeee....eeeeee..eeeeeee....eeeeeee...eeeeee..eeeee..hhhhhhhhhhhhhhhhh....eeeeee...hhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhh...eeeeeee........hhhhhhhhhhhhhhhhhheeeeeeeeeeeeee..... ..hhhhhhhhhhhh...eeeeeeee.hhhh.eeeeeeee..........hhhhhhhhhh.......hhhhhhhh...hhhhhhhhhhh.........eee.....eee...
sequence :  ..MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLTDPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTGMILL... ..RVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPY
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       ... ..204       214       224       234       244       254       264       274       284       294       304      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | ||         ||^**| |                     ||^**|            | || |   |   || |||^**||  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ||   |       ..PS00005..       |^**||| |  ^**     | |       | |        | |  ||| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           ^***         ||   | |                     ||^***            | ^***   |   || |||^***|  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ||   |       ..PS00006..       |^***|| |          | |       | |        | |  ||| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | ||         ||   | |                     ||                |  |     |   || ||||  ||  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ||   |       ..PS00007..       ********^          | |       | |        | |  ||| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | ||         ||   | |                     ||                |  |     |   ^*****|  ||  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ^*****       ..PS00008..        ||||||            | |       | |        ^*****|| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  PABS_1 ..           | ||         ||   | |                     ||                |  |     **************|  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || |||  |           ..PS01330..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | ||         ||   | |                     ||                |  |          | ||||   |  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || |||  |           ..alphabetamotif..        |*****            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | ||         ||   | |                     ||                |  |          | ||||   |  |  |      | *****          | ||| *****    *****                   |  | | || |   |  || |||  |           ..asxmotif..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | ||         ||   | |                     ||                |  |          | ||||   |  |  |      | ***            | ||| ***|                             |  *** || |   |  || |||  |           ..asxturn..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | ||         **   | |                     **                |  |          | ||||   |  |  |      | |              | ||| |  |                             |  | | || |   |  || |||  |           ..betabulge..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           | ||              | |                                       |  |          | ||||   |  |  |      | |              | ||| |  |                             |  | | || |   |  || |||  |           ..betabulgeloop..        ||||||            | |       | |        | |   || |||           |  |        |  | |          *****      
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | ||              | |                                       |  |          | ||||   |  |  |      | |              ****| ****                             |  | **** |   |  ****|****           ..betaturn..        *****|            | |       | |        | |   |****|           |  |        |  | |          ****|      
search RasMol script viewer Motif-ligand binding stats  nest ..           | ||              | |                                       |  |          ******   |  |  |      | |              ***** |  |                             |  |   |  |   |   |  ||  |           ..nest..          |  |            ***       | |        ***   |  ***           |  |        |  | |          | ***      
search RasMol script viewer Motif-ligand binding stats  niche ..           ****              | |                                       ****                   *******      ***                 *******                             ****   ****   |   ********           ..niche..          ****                      | |              |    |           ****        ******          | | |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..           | |               | |                                                                                                                                             |   |                      ..schellmannloop..                                    | |              ******                                       | | |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |               | |                                                                                                                                             *****                      ..stmotif..                                    | |                                                           *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***               ***                                                                                                                                                                        ..stturn..                                    ***                                                           ***        

chain B : POLYAMINE AMINOPROPYLTRANSFERASE
member of: CATH:search2.30.140.10/search3.40.50.150GENE3D:searchG3DSA_2.30.140.10/searchG3DSA_3.40.50.150HAMAP:searchMF_00198PANTHER:searchPTHR11558/searchPTHR11558_SF26PFAM:searchPF01564PROSITE PATTERNS:searchPS01330, PROSITE PROFILES:searchPS51006, SUPERFAMILY:searchSSF53335UniProt:searchQ5SK28
sec str:  .......eeeee....eeeeee..eeeeeee....eeeeeee...eeeeee..eeeee..hhhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhh....eeeeeee........hhhhhhhhhhhhhhhhh.eeeeeeeeeeeee......hhhhhhhhhhhh...eeeeeeee.hhhh.eeeeeeee........hhhhhhhhhhhh.......hhhhhhhh...hhhhhhhhhhh.........eee.....eee....
sequence :  ..MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLTDPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | ||         ||^**| ||                    ||^**|            | || |   |   || |||^**||  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ||   |     |  ||       |^**||| |  ^**  |  |||       | | |  |   |    |   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           ^***         ||   | ||                    ||^***            | ^***   |   || |||^***|  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ||   |     |  ||       |^***|| |       |  |||       | | |  |   |    |   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | ||         ||   | ||                    ||                |  |     |   || ||||  ||  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ||   |     |  ||       ********^       |  |||       | | |  |   |    |   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | ||         ||   | ||                    ||                |  |     |   ^*****|  ||  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ^*****     |  ||         || ||         |  |||       | | |  |   ^*****   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  PABS_1 ..           | ||         ||   | ||                    ||                |  |     **************|  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || |||  |         |  ||         || ||         |  |||       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | ||         ||   | ||                    ||                |  |          | ||||   |  |  |        |   |      ***** ||| | |||    |   ||  | |             |  | | || |   |  || |||  |         *****         *****         *****|       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | ||         ||   | ||                    ||                |  |          | ||||   |  |  |        *****      |  || ||| *****    *****|  | |             |  | | || |   |  || |||  |         |  |          || ||         |  | |       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | ||         ||   | ||                    ||                |  |          | ||||   |  |  |                   |  || ||| ***|          |  | |             |  *** || |   |  || |||  |         |  |          || ||         |  | |       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | ||         **   | ||                    **                |  |          | ||||   |  |  |                   |  || ||| |  |          |  | |             |  | | || |   |  || |||  |         |  |          || ||         |  | |       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           | ||              | ||                                      |  |          | ||||   |  |  |                   |  || ||| |  |          |  | |             |  | | || |   |  || |||  |         |  |          || ||         ******       | | |  |            | |           |  |        |  | |          *****       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | ||              | ||                                      |  |          | ||||   |  |  |                   **************          |  | |             |  | **** |   |  ****||  |         ****          ****|         **** |       | | ****            | |           |  |        |  | |          ****|       
search RasMol script viewer Motif-ligand binding stats  nest ..           | ||              | ||                                      |  |          ******   |  |  |                       ***** |  |          |  | |             |  |   |  |   |   |  ||  |                        |  |            ***       | |                 ***           |  |        |  | |          | ***       
search RasMol script viewer Motif-ligand binding stats  niche ..           ****              ****                                      ****                   *******                          *******          ******             ****   ****   |   ********                        ****                      | |                               ****        ******          | | |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |               | |                                                                                                                   | |                       *****                                                             | |                                                           *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***               ***                                                                                                                   ***                                                                                         ***                                                           ***         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYAMINE AMINOPROPYLTRANSFERASE
member of: CATH:search2.30.140.10/search3.40.50.150GENE3D:searchG3DSA_2.30.140.10/searchG3DSA_3.40.50.150HAMAP:searchMF_00198PANTHER:searchPTHR11558/searchPTHR11558_SF26PFAM:searchPF01564PROSITE PATTERNS:searchPS01330, PROSITE PROFILES:searchPS51006, SUPERFAMILY:searchSSF53335UniProt:searchQ5SK28
sec str:  .......eeeee....eeeeee..eeeeeee....eeeeeee...eeeeee..eeeee..hhhhhhhhhhhhhhhhh....eeeeee...hhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhh...eeeeeee........hhhhhhhhhhhhhhhhhheeeeeeeeeeeeee..... ..hhhhhhhhhhhh...eeeeeeee.hhhh.eeeeeeee..........hhhhhhhhhh.......hhhhhhhh...hhhhhhhhhhh.........eee.....eee...
sequence :  ..MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLTDPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTGMILL... ..RVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPY
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       ... ..204       214       224       234       244       254       264       274       284       294       304      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | ||         ||^**| |                     ||^**|            | || |   |   || |||^**||  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ||   |       ..PS00005..       |^**||| |  ^**     | |       | |        | |  ||| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           ^***         ||   | |                     ||^***            | ^***   |   || |||^***|  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ||   |       ..PS00006..       |^***|| |          | |       | |        | |  ||| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | ||         ||   | |                     ||                |  |     |   || ||||  ||  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ||   |       ..PS00007..       ********^          | |       | |        | |  ||| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | ||         ||   | |                     ||                |  |     |   ^*****|  ||  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || ||| ^*****       ..PS00008..        ||||||            | |       | |        ^*****|| |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  PABS_1 ..           | ||         ||   | |                     ||                |  |     **************|  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || |||  |           ..PS01330..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | ||         ||   | |                     ||                |  |          | ||||   |  |  |      | | | |          | ||| | |||    |   |                   |  | | || |   |  || |||  |           ..alphabetamotif..        |*****            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | ||         ||   | |                     ||                |  |          | ||||   |  |  |      | *****          | ||| *****    *****                   |  | | || |   |  || |||  |           ..asxmotif..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | ||         ||   | |                     ||                |  |          | ||||   |  |  |      | ***            | ||| ***|                             |  *** || |   |  || |||  |           ..asxturn..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | ||         **   | |                     **                |  |          | ||||   |  |  |      | |              | ||| |  |                             |  | | || |   |  || |||  |           ..betabulge..        ||||||            | |       | |        | |   || |||           |  |        |  | |          | |||      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           | ||              | |                                       |  |          | ||||   |  |  |      | |              | ||| |  |                             |  | | || |   |  || |||  |           ..betabulgeloop..        ||||||            | |       | |        | |   || |||           |  |        |  | |          *****      
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | ||              | |                                       |  |          | ||||   |  |  |      | |              ****| ****                             |  | **** |   |  ****|****           ..betaturn..        *****|            | |       | |        | |   |****|           |  |        |  | |          ****|      
search RasMol script viewer Motif-ligand binding stats  nest ..           | ||              | |                                       |  |          ******   |  |  |      | |              ***** |  |                             |  |   |  |   |   |  ||  |           ..nest..          |  |            ***       | |        ***   |  ***           |  |        |  | |          | ***      
search RasMol script viewer Motif-ligand binding stats  niche ..           ****              | |                                       ****                   *******      ***                 *******                             ****   ****   |   ********           ..niche..          ****                      | |              |    |           ****        ******          | | |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..           | |               | |                                                                                                                                             |   |                      ..schellmannloop..                                    | |              ******                                       | | |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |               | |                                                                                                                                             *****                      ..stmotif..                                    | |                                                           *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***               ***                                                                                                                                                                        ..stturn..                                    ***                                                           ***        

chain B : POLYAMINE AMINOPROPYLTRANSFERASE
member of: CATH:search2.30.140.10/search3.40.50.150GENE3D:searchG3DSA_2.30.140.10/searchG3DSA_3.40.50.150HAMAP:searchMF_00198PANTHER:searchPTHR11558/searchPTHR11558_SF26PFAM:searchPF01564PROSITE PATTERNS:searchPS01330, PROSITE PROFILES:searchPS51006, SUPERFAMILY:searchSSF53335UniProt:searchQ5SK28
sec str:  .......eeeee....eeeeee..eeeeeee....eeeeeee...eeeeee..eeeee..hhhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhh....eeeeeee........hhhhhhhhhhhhhhhhh.eeeeeeeeeeeee......hhhhhhhhhhhh...eeeeeeee.hhhh.eeeeeeee........hhhhhhhhhhhh.......hhhhhhhh...hhhhhhhhhhh.........eee.....eee....
sequence :  ..MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLTDPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTGMILLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAFDPAAFSEGVIEARIRERNLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQAPYK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | ||         ||^**| ||                    ||^**|            | || |   |   || |||^**||  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ||   |     |  ||       |^**||| |  ^**  |  |||       | | |  |   |    |   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           ^***         ||   | ||                    ||^***            | ^***   |   || |||^***|  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ||   |     |  ||       |^***|| |       |  |||       | | |  |   |    |   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           | ||         ||   | ||                    ||                |  |     |   || ||||  ||  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ||   |     |  ||       ********^       |  |||       | | |  |   |    |   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | ||         ||   | ||                    ||                |  |     |   ^*****|  ||  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || ||| ^*****     |  ||         || ||         |  |||       | | |  |   ^*****   | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  PABS_1 ..           | ||         ||   | ||                    ||                |  |     **************|  |  |        |   |      |  || ||| | |||    |   ||  | |             |  | | || |   |  || |||  |         |  ||         || ||         |  |||       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | ||         ||   | ||                    ||                |  |          | ||||   |  |  |        |   |      ***** ||| | |||    |   ||  | |             |  | | || |   |  || |||  |         *****         *****         *****|       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | ||         ||   | ||                    ||                |  |          | ||||   |  |  |        *****      |  || ||| *****    *****|  | |             |  | | || |   |  || |||  |         |  |          || ||         |  | |       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | ||         ||   | ||                    ||                |  |          | ||||   |  |  |                   |  || ||| ***|          |  | |             |  *** || |   |  || |||  |         |  |          || ||         |  | |       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | ||         **   | ||                    **                |  |          | ||||   |  |  |                   |  || ||| |  |          |  | |             |  | | || |   |  || |||  |         |  |          || ||         |  | |       | | |  |            | |           |  |        |  | |          | |||       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           | ||              | ||                                      |  |          | ||||   |  |  |                   |  || ||| |  |          |  | |             |  | | || |   |  || |||  |         |  |          || ||         ******       | | |  |            | |           |  |        |  | |          *****       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | ||              | ||                                      |  |          | ||||   |  |  |                   **************          |  | |             |  | **** |   |  ****||  |         ****          ****|         **** |       | | ****            | |           |  |        |  | |          ****|       
search RasMol script viewer Motif-ligand binding stats  nest ..           | ||              | ||                                      |  |          ******   |  |  |                       ***** |  |          |  | |             |  |   |  |   |   |  ||  |                        |  |            ***       | |                 ***           |  |        |  | |          | ***       
search RasMol script viewer Motif-ligand binding stats  niche ..           ****              ****                                      ****                   *******                          *******          ******             ****   ****   |   ********                        ****                      | |                               ****        ******          | | |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |               | |                                                                                                                   | |                       *****                                                             | |                                                           *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***               ***                                                                                                                   ***                                                                                         ***                                                           ***         

   New search    1uir:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors