triangle PDBeMotif: 1u4e  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification metal transport    | release date: Sat, Jul 24, 2004
Title crystal structure of cytoplasmic domains of girk1 channel
Authors C.ARRABIT, P.A.SLESINGER, S.CHOE, S.PEGAN, W.KWIATKOWSKI, W.ZHOU
Method X-RAY DIFFRACTION (resolution: 2.09Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PRGSHGKKRQRFVDKNGRCNVQHGNLGSEKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTP
EGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTED
EVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : G PROTEIN-ACTIVATED INWARD RECTIFIER POTASSIUM CH
member of: CATH:search2.60.40.1400GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF16PFAM:searchPF01007PRINTS:searchKIR31CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP63250
sec str:  ...............eeee........eee...eeeeee..eeeeeeeeee.....eeeeeeeeeeeeeee.....eeeeeeee.................eeeeee..........hhhhhh....eeeeeeeeee.....eeeeeeeee...eee.eee...eeee..eeeee.hhh..eee......hhhhhhhh......
sequence :  ..KRQRFVDKNGRCNVQHGNL..RAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSP
seq num:  ..42        52       ..190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|     | |||     |  ..             ^**| |       || | |                | |||         ||||||||||             |  | |  |^** |  |         | |  | |      | || |||  |      |  |        |  |      | |^**|||  ||| | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|     | |||     |  ..             ^*** |       || | |                | |||         |||||^***|             |  | |  |    |  |         | |  | |      ^*** |||  |      ^***        |  |      | |^***||  ||| | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|     | |||     ^**..               |  |       ^*****                | |||         ||||||||||             |  | |  |    |  |         ^***** |        || |||  |                  |  |      | ||   ||  ||| | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..*     | |||        ..               |  |        | | |                | |||         ||||||||||             |  | |  |    |  |           |  | |        || |||  |                  |  |      | ||   ||  ||| | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |||        ..               |  |        | | |                | |||         ||||||||||             |  | |  |    |  |           |  | |        || |||  |                  |  |      | ||   |*****| | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | ***        ..               |  |        | | |                | |||         ***|||||||             |  | |  |    |  |           |  | |        || |||  |                  |  |      | ||   ||  | | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      *****        ..               |  |        | | |                *****          |||||||||             |  | |  |    |  |           ******        || |||  |                  |  |      | ||   ||  | | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|        ..               ****        | | |                ****|          |||||||||             **** ****    |  |              | |        ****||  |                  |  |      | ||   |**** | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |        ..                           | | |                | | |          |||||||||             |  | |  |    |  |              | |         |  ||  |                  |  |      | ||   |     *** 
search RasMol script viewer Motif-ligand binding stats  nest ..        ***        ..                           | | |                | ***          ********|             |  | |  |    |  |              ***         |  ||  |                  |  |      | ||   |         
search RasMol script viewer Motif-ligand binding stats  niche ..                   ..                           *****                | | |              |****             **** ****    ****              | |         ********                  ****      ***|   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   ..                                                *****              | |                                              | |                                                *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ..                                                ***                ***                                              ***                                                              

   New search    1u4e:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors