triangle PDBeMotif: 1tlf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription regulation    | release date: Mon, Mar 6, 1995
Title unprecedented quaternary structure of e. coli lac repressor core tetramer: implications for dna looping
Authors A.M.FRIEDMAN, T.A.STEITZ, T.O.FISCHMANN
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search IPT IPT binding statistics IPT   search EMC EMC binding statistics EMC
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
QSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAA
CTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGD
WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQT
SVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF13377SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
JMol viewer RasMol script viewer  IPT 998A  ..            * **                                                                       **                                           *   *                      *                         *                           *                                                                                  
JMol viewer RasMol script viewer  EMC 999B  ..            | ||                                                                       ||                                           |   |                      |  *                      |                           |                                                                                  
JMol viewer RasMol script viewer  EMC 999A  ..            | ||                                                                       ||                                           |   |                      |  |                      |                           |     **                                                                           
sec str:  ....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhh.....eeeeeee..hhhhhhhhhh.....eeeee........eeee.hhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhh......eeee..hhhhhhhhhhhhh.........eeeeee............eeee..hhhhhhhhhhhhhhhh.......eeee..eee..............hhhhhhhhhhhhhhhhh.
sequence :  ..SLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRL
seq num:  ..61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |    |  |           |  | | |    |  | || || ||| | ||||   |    |   | |||||| |||||       |  | |     || |||  ||  || |||| |     |  ||| ||||||||| || |||              | |||||||||||   |    | | |||  |||  |||  ||  |        || ||     | | | | | ||||| |  | | | | |         **^*|        | || ||||||||  || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |    |  |           |  | | |    |  | || || ||| | ||||   |    |   | |||||| |||||       |  | |     || |||  ||  || |||| |     |  ||^**|||||||| || |||              | |||||||||||   |    | | |||  |||  |||  ||  |        || ||     ^** | | | ||||| |  | | | | |          |  |        ^**| ||||||||  || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |    |  |           ^*** | |    ^*** ^***| ||| | ||||   |    |   | |||||| |||||       |  | |     ^***||  ||  || |||| |     |  ||| ||||||||| || |||              | |||||||||||   |    | | |||  |||  |||  ||  |        || ||         | | | |^*** |  | | | | |          |  |           | ||||||||  |^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ^*****  |                | |          ^*****|| | ||||   ^*****   | |||||| |||||       |  | |      |  ^*****  || |||| |     |  ||| ||||||||| || |||              | |||||||||^*****    | | ||^*****  |^*****  |        || ||         | | | | ||  |  | | | | |          |  |           | ||||||||  || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |                | |             ***** *****|            ******** |||||       |  | |      |   |  |   || |||| |     |  ||| |*******| || |||              | *********||        | | ||*****|  | |  |   |        *****         | | | | ||  |  | | | | |          |  |           **********  || |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |                | |             |  |  | || |            | || ||| |||||       |  | |      |   |  |   || |||| |     |  ||| ||||||||| || |||              | ||||| |||||        *****||  | |  | |  |   |        || ||         | | | | ||  |  | | | | |          |  |           | || || ||  || |
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |                | |             |  |  | || |            | || ||| |||||       |  | |      |   |  |   || |||| |     |  ||| ||||||||| || |||              | ||||| |||||          |  ||  | |  | |  |   |        || ||         *** | | ||  |  | | | | |          |  |           | || || ||  || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |                | |             ****  ******            **************       |  | |      |   ****   |****|| |     |  |************ *****|              | **********|          ******** **** |  |   |        ****|             | ****  **** | | | |          |  |           *********|  ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |                | |                                               |***       |  ***      |   |      |  | |***     |  |          |  || | |              |   |     | |                      | |  |   |         |  |             |   |        | | ***          |  |                    |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                ***                                               ***        |  |        |   |      |  ***        |  |          |  || ***              |   |     ***                      ***  |   |         |  |             |   |        ***              |  |                    |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                                                                             ****        |   |      |    |        ****          |  ||   |              |   |                                   |   |         ****             |   |                         ****                    |   |  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                      |   |      ******                      |  ******              |   |                                   |   |                          |   |                                                 |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                      *****                                  *****                  *****                                   *****                          *****                                                 *****  

chain B : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF13377SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
JMol viewer RasMol script viewer  IPT 998B  ..        *     **                        *                       *                       *                                           *   *                      *                         *                           *                                                                                  
JMol viewer RasMol script viewer  EMC 999B  ..        |     ||                        |                       |                       |                                           |   |                      |                         |                           |     **                                            *                              
JMol viewer RasMol script viewer  EMC 999A  ..        |     ||                        |                       |                       |                                           |   |                      |                         |                           |     ||                                            |                              
sec str:  ....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhh.....eeeeeee..hhhhhhhhhh.....eeeee........eeee.hhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhh......eeee..hhhhhhhhhhhhh.........eeeeee............eeee..hhhhhhhhhhhhhhhh.......eeee..eee..............hhhhhhhhhhhhhhhhh.
sequence :  ..SLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRL
seq num:  ..61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |    | ||  |||||||| |||||| |    |  | || |  | || ||| | | |    |          |  |             | | |   |  ||    || |||||| |      |  | | ||        |  | |        | |   | | |||   |||   |    | | ||||||||| |||  ||  |        ||| |     | |        ||||||||||| | |           **^*|        | ||  || |  || ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |    | ||  |||||||| |||||| |    |  | || |  | || ||| | | |    |          |  |             | | |   |  ||    || |||||| |      |  | ^**|        |  | |        | |   | | |||   |||   |    | | ||||||||| |||  ||  |        ||| |     ^**        ||||||||||| | |            |  |        ^**|  || |  || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |    | ||  |||||||| ^***|| |    ^*** ^***  | || ||| | | |    |          |  |             | | |   ^***|    || |||||| |      |  | |  |        |  | |        | |   | | |||   |||   |    | | ||||||||| |||  ||  |        ||| |                ^***||||||| | |            |  |           |  || |  || |^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ^***** ||  |||||||| |||||| |       | |^***** || ||| | | ^*****          |  |             | | |       ^*****| |||||| |      |  | |  |        |  | |        | |   | | |||   |^*****    | | ||^*****| |^*****  |        ||| |                 |||||||||| | |            |  |           |  || |  || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | ||  |||************ |       | |       ****** | |                 |  |             | | |             *****||| |      |  | |  |        |  | |        | |   | *****   | |        | | |*******| | |  |   |        ||| |                 ||*******| | |            |  |           ***** ********  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | ||  |||||||  |||||| |       | |       || ||  | |                 |  |             | | |             | || ||| |      |  | |  |        |  | |        | |   | | ||    | |        *****| || ||| | |  |   |        ||| |                 |||||||| | | |            |  |           |  |  |  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | ||  *************** |       | |       ******** |                 ****             | | |             *******| |      **** ****        **** |        | |   | ****    | |          ************* |  |   |        |****                 ********** | |            |  |           ****  *******   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | ||                | |       | |              | |                                  *****               |  | | |      |  |                | |        | |   |   |     | |                | | | | |  |   |        | |                            | ***            |  |                           
search RasMol script viewer Motif-ligand binding stats  nest ..         | ||                ***       ***              ***                                                      |  *** |      |  |                ***        ***   |   |     ***                | | | ***  |   |        | |                            ***              |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                                                                                                    |    ***      ****                             |   |   |                        | | | |    |   |        ***                                             ****                           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..         | |                                                                                                     ******                                         |   |   |                        | | | |    |   |                                                                                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..         | |                                                                                                                                                    *****   |                        | | | |    |   |                                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..         | |                                                                                                                                                        *****                        *******    *****                                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..         ***                                                                                                                                                                                                                                                                                            

chain C : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF13377SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
JMol viewer RasMol script viewer  IPT 998C  ..        *     **  *                                                                     *                                           *   *                      *                         *                           *                                                                                  
JMol viewer RasMol script viewer  EMC 999D  ..        |     ||  |                                                                     |                                           |   |                      |                         |                           |                                                                                  
JMol viewer RasMol script viewer  EMC 999C  ..        |     ||  |                                                                     |                                           |   |                      |                         |                           |                                                   *                              
sec str:  ....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhh.....eeeeeee..hhhhhhhhhh.....eeeee........eeee.hhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhh......eeee..hhhhhhhhhhhhh.........eeeeee............eeee..hhhhhhhhhhhhhhhh.......eeee..eee..............hhhhhhhhhhhhhhhhh.
sequence :  ..SLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRL
seq num:  ..61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |    |  |  || |||||||| ||| |    |  | || || ||| |||| | | |    |   |  || || ||| |       |  |       |  || || ||||||||| |      |  | ||| |||  || || | |        | |  || | ||| |||||   |      | ||||| ||| |||   |         |  |        | |     |  || |  ||   | || |         **^*|        | ||  | |||||||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |    |  |  || |||||||| ||| |    |  | || || ||| |||| | | |    |   |  || || ||| |       |  |       |  || || ||||||||| |      |  | ^** |||  || || | |        | |  || | ||| |||||   |      | ||||| ||| |||   |         |  |        ^**     |  || |  ||   | || |          |  |        ^**|  | |||||||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |    |  |  || ||||||^***|| |    ^*** ^***| ||| |||| | | |    |   |  || || ||| |       |  |       ^***| || ||||||||| |      |  |  || |||  || || | |        | |  || | ||| |||||   |      | ||||| ||| |||   |         |  |                |  ^***  ||   | || |          |  |           |  | ||||||||^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ^*****  |  || ||||||||  || |       | |^*****|| |||| | | ^*****   |  || || ||| |       |  |          |^*****|||||||| |      |  |  || |||  || || | |        | |  || | ||| |||^*****      | ||^*****| |^*****         |  |                |   | |  ||   | || |          |  |           |  | ||||||||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |  *************** |       | |  |*********| | |          ***** || ||| |       |  |          *****  |*****|| |      |  |  ********** || | |        | |  || *********||          ******* ||| |||             |  |                |   | *****   | || |          |  |           |  **********   
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |  || | || | |  || |       | |  || ||| || | | |          |  |  || ||| |       |  |          |  |   |||||||| |      |  |  || |||  |  || | |        ***  || | ||| |||||          | || |  ||| |||             |  |                |   | |  |    | || |          |  |           |  | |||||||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |  ********* ****| |       | |  *********** | |          ****  ********       |  |          ****   *******| |      |  |  *********  **** |        | ****************|          **************|             ****                |   | ****    | || |          |  |           ************    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |   |            | |       | |              | |                   ***         |  |                   |  | | |      |  |          |   | | |        | |   |   |     | |                  ||  | |                                 |   |         ******          |  |                           
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |   |            ***       ***              ***                               |  |                   |  *** |      |  |          |   | ***        ***   |   |     ***                  ||  ***                                 |   |                         |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****   |                                                                         ****                   |    ***      ****          |   |                  |   |                          ||  | |                                 |   |                         ****                           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |   |                                                                                                ******                      |   |                  |   |                          |******                                 |   |                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                                                                                                                            *****                  *****                          *****                                   *****                                                        

chain D : LAC REPRESSOR
member of: CATH:search3.40.50.2300GENE3D:searchG3DSA_1.10.260.40/searchG3DSA_3.40.50.2300PANTHER:searchPTHR30146/searchPTHR30146_SF30PFAM:searchPF13377SMART:searchSM00354SUPERFAMILY:searchSSF47413/searchSSF53822UniProt:searchP03023
JMol viewer RasMol script viewer  IPT 998D  ..              **                        *                                              **                                           *   *                      *                         *                           *                                                                                  
JMol viewer RasMol script viewer  EMC 999D  ..              ||                        |                                              ||                                           |   |                      |                         |                           |* *   *        *                                                                  
JMol viewer RasMol script viewer  EMC 999C  ..              ||                        |                                              ||                                           |   |                      |                         |                           || |   |        |                                                                  
sec str:  ....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhh.....eeeeeee..hhhhhhhhhh.....eeeee........eeee.hhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhh......eeee..hhhhhhhhhhhhh.........eeeeee............eeee..hhhhhhhhhhhhhhhh.......eeee..eee..............hhhhhhhhhhhhhhhhh.
sequence :  ..SLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRL
seq num:  ..61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |    |  |  |  ||| |||  | | |    |  | || |  |||  ||  | | |    |      | |||||           |  | |    ||| |||  ||   | |||        |  | | |||| |||  || | |              |   |  || |||   |    || ||||    |  |||  ||  |                  | |||||||  |  |   |  | | | |         **^*         | ||  || || || || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |    |  |  |  ||| |||  | | |    |  | || |  |||  ||  | | |    |      | |||||           |  | |    ||| |||  ||   | |||        |  | ^**||| |||  || | |              |   |  || |||   |    || ||||    |  |||  ||  |                  ^**||||||  |  |   |  | | | |                      ^**|  || || || || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |    |  |  |  ||| ||^*** | |    ^*** ^***  |||  ||  | | |    |      | |||||           |  | |    |^***||  ||   | |||        |  | | |||| |||  || | |              |   |  || |||   |    || ||||    |  |||  ||  |                     ||||||  ^***   |  | | | |                         |  || || || |^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ^*****  |  |  ||| |||    | |       | |^*****||  ||  | | ^*****      | |||||           |  | |    | |  ^*****   | |||        |  | | |||| |||  || | |              |   |  || |^*****    || |||^*****  |^*****  |                     ||||||         |  | | | |                         |  || || || || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |  |  ||*****    | |       | |  **********  | |             *******           |  | |    | |   |  |    | |||        |  | | ||******  || | |              |   ***** |||        ******     *****|  |   |                     |*****         |  | | | |                         ************** |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |  |  ||| ||     | |       | |  |  | |  |   | |             | || |            |  | |    | |   |  |    | |||        |  | | |||| |||  || | |              |   |  || |||        || ||      |  | |  |   |                     |*****         |  | | | |                         |  |  |  || || |
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |  |  ||| ||     | |       | |  |  | |  |   | |             | || |            |  | |    | |   |  |    | |||        |  | | |||| |||  || | |              |   |  || |||        || ||      |  | |  |   |                     |***|          |  | | | |                         |  |  |  || || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |  *********     | |       | |  **** ****   | |             ******            |  | |    | |   ****    ****|        **** *********|  **** |              |   ********|        *****      **** |  |   |                     |****          **** | | |                         ****************
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |                | |       ***              ***                               |  ***    ***             | |        |  |          |   | | |              |   |     | |                      | |  |   |                     ***               | | | |                                         
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                ***                                                          |  |                      ***        |  |          |   | ***              |   |     ***                      ***  |   |                                       *** ***                                         
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                                                                             ****                                 ****          |   |                  |   |                                   |   |                                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                             *****                  *****                                   *****                                                                                       

   New search    1tlf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML