triangle PDBeMotif: 1tff  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.
Classification hydrolase    | release date: Thu, May 27, 2004
Title structure of otubain-2
Authors A.DESSEN, J.CHROBOCZEK, M.H.NANAO, M.Y.BALAKIREV, O.DIDEBERG, S.O.TCHERNIUK
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDRNCFYRALGYSYLESLLGKSREIFKFKERVLQ
TPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDI
KDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN THIOLESTERASE PROTEIN OTUB2
member of: PANTHER:searchPTHR12931/searchPTHR12931_SF3PFAM:searchPF10275PIRSF:searchPIRSF013503PROSITE PROFILES:searchPS50802, SUPERFAMILY:searchSSF54001UniProt:searchQ96DC9
sec str:  ...........hhhhhh.hhhhhhhhhhhhhhhheeeee......hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.......hhhhhhhhhhhhh..eeeee..... .............eeeeee..eeeeeee....
sequence :  ..NLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDRNCFYRALGYSYLESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVD... ..HHVFPEAATPSVYLLYKTSHYNILYAADKH
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187        ... ..205       215       225       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |       |       |      ||**^*    |  ||||       | || || |          |  |  ||| ||||  ||        |  |    |||   |  |  | |  |     |   |          || ||| |||        | |  |  |   |   |  | |        ..PS00004..                              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**       |       |      |^**|     |  ||||       | || || |          |  |  ||| ||||  ||        |  |    |||   |  |  | |  |     |   |          || ||| |||        | |  |  |   |   |  | |        ..PS00005..                              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             |       |      || ||     ^***|||       ^*** || |          |  ^***|| ||||  ||        ^***    |||   |  |  | ^***     |   |          || ||| |||        | |  ^***   |   |  | |        ..PS00006..                              
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             ********^      || ||        ||||         || || |          |  |   || ||||  ||                |||   |  |  |          |   |          || ||| |||        | |  |      |   |  | |        ..PS00007..                              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                            || ||        ||||         || || |          |  |   || ||||  ||                |^*****  |  |          |   |          || ||| |||        | |  |      |   |  | |        ..PS00008..                              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                            *****        ||||         || || |          |  |   || |||*****                | |   |  |  |          |   |          || ||| |||        | |  |      |   |  | |        ..alphabetamotif..                              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                            || ||        ||||         || || |          |  |   || ||||  |                 | |   |  |  |          |   |          || ||*****        | |  |      |   |  | |        ..asxmotif..                              
search RasMol script viewer Motif-ligand binding stats  asxturn ..                            || ||        ||||         || || |          |  |   || ||||  |                 ***   |  |  |          |   |          || ||***|         | |  |      |   |  | |        ..asxturn..                              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                            ****|        ||||         *******          ****   |****|****                 | |   |  ****          |   |          ****|****         | |  |      |   |  | |        ..betaturn..                              
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |        ****          | || |                 |  ***                     ***   |  |  |          |   |           |  ||  |         | |  |      |   |  ***        ..nest..                              
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                      ******                 |    |                       |   |  ****          |   |           ********         ******      |   |             ..niche..                              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                              ******                       |   |                |   |                                        |   |             ..schellmannloop..                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                           *****                |   |                                        |   |             ..stmotif..                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                *****                                        *****             ..ststaple..                              

   New search    1tff:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML