triangle PDBeMotif: 1t65  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hormone/growth factor    | release date: Wed, May 5, 2004
Title crystal structure of the androgen receptor ligand binding domain with dht and a peptide derived form its physiological coactivator grip1 nr box 2 bound in a non- helical conformation
Authors E.DELGADORODRIGUES, E.ESTEBANEZ-PERPINA, E.MAR, J.D.BAXTER, J.M.R.MOORE, P.NGUYEN, P.WEBB, R.J.FLETTERICK, R.K.GUY
Method X-RAY DIFFRACTION (resolution: 1.66Å)
PDBe Citation   
Small molecules:    search DHT DHT binding statistics DHT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
CQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFA
MGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFD
ELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILS
GKVKPIYFHTQ
Chain B sequence:
KHKILHRLLQDSS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ANDROGEN RECEPTOR
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24084/searchPTHR24084_SF6PFAM:searchPF00104SMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP10275
JMol viewer RasMol script viewer  DHT 931A  ..                                   **     *                              *  *   *  *           *               *                                                                                               **                 *                        
sec str:  ....hhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..eee.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee......
sequence :  ..CQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
seq num:  ..669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  | |   |||| ||         |  |           || || |||||                      |   | | | |   |  |  |   |  | |             || ||||  ||     |   |  |  |  |   |                | |      ^**|   |                      |  || |      |   |   |   ^**|   | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  | |   |||| ||         ^***           || || |||||                      |   | | | |   |  |  |   |  | |             || |||^***|     |   |  |  |  |   |                | |         |   |                      |  || |      |   |   |   ||||   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  | ^*****|| ||                        || || |||||                      |   | | | |   |  |  |   |  | |             || ||||   |     |   |  |  |  |   |                | |         |   |                      |  || |      |   |   |   ||||   | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |     | || ||                        || || |||||                      |   | | | |   |  |  |   |  | |             || ||||   |     |   |  |  |  |   |                | |         |   |                      ***** |      |   |   |   ||||   | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |     | || ||                        || || |||||                      |   | | | |   |  |  *****  | |             || ||||   |     |   |  |  |  *****                | |         |   |                      |  || |      |   |   |   ||||   | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |     | |***|                        || || |||||                      |   | | | |   |  |         | |             || ||||   |     |   |  |  |                       | |         |   |                      |  || |      |   |   |   ||||   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |     | ||  |                        ****| ****|                      |   | | | |   ****         | |             |****||   |     |   |  ****                       | |         |   |                      ****| |      |   |   |   ||||   | |  
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |     ***|  |                         |  | *** |                      |   | *****                ***             |  ***|   |     |   |                             | |         |   |                          ***      |   |   |   ****   | |  
search RasMol script viewer Motif-ligand binding stats  niche ..         ****        ****                         ****  ****                      |   |                      | |             |    ||   |     |   |                             ***         |   |                                   |   |   |   |      ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                  |   |                      | |             ******|   |     |   |                                         |   |                                   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                  |   |                      | |                   *****     |   |                                         |   |                                   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                  *****                      | |                             *****                                         *****                                   *****   *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                             ***                                                                                                                                           

chain B : NUCLEAR RECEPTOR COACTIVATOR 2
member of: GENE3D:searchG3DSA_4.10.630.10PANTHER:searchPTHR10684/searchPTHR10684_SF2PFAM:searchPF08832PIRSF:searchPIRSF038181UniProt:searchQ15596
sec str:  .....eee.
sequence :  ..HKILHRL
seq num:  ..920    

   New search    1t65:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors