triangle PDBeMotif: 1sot  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.
Classification hydrolase    | release date: Mon, Mar 15, 2004
Title crystal structure of the degs stress sensor
Authors C.WILKEN, K.KITZING, M.EHRMANN, R.KURZBAUER, T.CLAUSEN
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGS
DSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNS
GGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQG
IVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATNHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEASE DEGS
member of: CATH:search2.30.42.10/search2.40.10.10GENE3D:searchG3DSA_2.30.42.10/searchG3DSA_2.40.10.10PANTHER:searchPTHR22939/searchPTHR22939_SF80PFAM:searchPF00089/searchPF00595PRINTS:searchPROTEASES2CPROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156/searchSSF50494TIGRFAMS:searchTIGR02038UniProt:searchP0AEE3
sec str:  .......hhhhhhhhh..eeeeeeee.........eeeeeeeeee.....eeeeehhhhh...eeeee.....eeeeeeeeee....eeeeee.....................eeeeee.......eeeeeeeee.........hhhhheee...........eeee....eeeeee....... .....eeeeehhhhhhhhhhhhhh.....ee.........ee...................ee..........hhhhhhhhhhh....eeee.......eeee.ee...
sequence :  ..MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFD... ..EGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR..GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVV..QLTLQVTIQEYPA
seq num:  ..42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       ... ..230       240       250       260  ..281       291       301       311       321       331  ..341          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |      |  |      |    || |            | |||  ||||||| |||      | |         || |||     ^***    |  | ||| |  |     |    ||    ||  ||| | | | |||  |  | |   |||||||  |||||          ..PS00001.. |    |                            ..| | ||       | |||   |           |  |    |  ||  |      .. | |  |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |      |  |      |    || |            | |||  ^**|||| |||      | |         || |||        |    |  | ||| |  |     |    ||    ||  ||^** | | ^**  |  | |   |||||||  |||||          ..PS00005.. |    |                            ..| | ||       | |||   |           |  |    |  ||  |      .. | |  |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |      |  |      |    || |            | |||   | |||| |||      | |         |^***|        |    |  | ||| |  |     |    ||    ||  ||| | | |  ||  |  | |   |||||||  |^***          ..PS00006.. |    |                            ..| | ||       | |||   |           ^***    |  ||  |      .. | |  ^***   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |      |  |      ^*****| |            | |||   | |||| |||      | |         |  |||        ^*****  | ||| |  |     ^*****^*****^***** | ^*****|  |  | |   |^*****  | |||          ..PS00008.. ^*****                            ..^*****       | |^*****                   |  ||  |      .. | |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |      |  |            | |            *****   | |||| |||      | |         |  |||                ***** |  |                    ||  | | |   |  |  | |   ||||||   | |||          ..asxmotif..                                   ..  | |        | | |                       |  ||  |      .. | |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |      |  |            | |            ***||   | |||| |||      ***         |  |||                ***|  |  |                    ||  | | |   |  |  | |   ||||||   | |||          ..asxturn..                                   ..  | |        | | |                       |  ||  |      .. | |         
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | |      |  |            | |            | |||   | |||| |**      | |         |  |||                |  |  |  |                    **  | | |   |  |  | |   ||||||   | |||          ..betabulge..                                   ..  | |        | | |                       |  ||  |      .. | |         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    | |      |  |            | |            | |||   | |||| |        | |         ******                |  |  |  |                        | | |   |  |  | |   ||||||   *****          ..betabulgeloop..                                   ..  | |        | | |                       |  ||  |      .. | |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |      |  |            | |            ****|   ****|| |        | |            |||                ****  ****                        | | |   ****  | |   ||****   ****|          ..betaturn..                                   ..  | |        | | |                       ********      .. | |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |      |  |            | |              | |     | || |        | |            |||                |  |  |  |                        | | |   |  |  | |   |||||      | |          ..gammaturn..                                   ..  ***        *****                       |  ||  |      .. ***         
search RasMol script viewer Motif-ligand binding stats  nest ..    | |      |  |            ***              ***     | || |        ***            ***                |  |  |  |                        | | |   |  |  | |   |||||      ***          ..nest..                                   ..                                         |  ||  |      ..             
search RasMol script viewer Motif-ligand binding stats  niche ..    | |      ****                                     ******                        |                 ****  ****                        *****   ****  ***   ****|                   ..niche..                                   ..                                         ********      ..             
search RasMol script viewer Motif-ligand binding stats  stturn ..    ***                                               |                             |                                                                 ***    ||||                   ..stturn..                                   ..                                                       ..             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                      *                             *                                                                        ****                   ..REP00000..                                   ..                                                       ..             

chain B : PROTEASE DEGS
member of: CATH:search2.30.42.10/search2.40.10.10GENE3D:searchG3DSA_2.30.42.10/searchG3DSA_2.40.10.10PANTHER:searchPTHR22939/searchPTHR22939_SF80PFAM:searchPF00089/searchPF00595PRINTS:searchPROTEASES2CPROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156/searchSSF50494TIGRFAMS:searchTIGR02038UniProt:searchP0AEE3
sec str:  .......hhhhhhhhh..eeeeeeee.........eeeeeeeeee.....eeeeehhhhh...eeeee.....eeeeeeeeee....eeeee......................eeeeee.......eeeeeeeee.........hhhhheee...........eeee....eeeeee....... ......eeeeehhhhhhhhhhhhhhh....ee..........ee...................eeeee......hhhhhhhhhhh.....eeeeee....eeeeee.ee...........
sequence :  ..MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFD... ..PEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR..QGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVM..QLTLQVTIQEYPATNHHHHHH
seq num:  ..42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       ... ..229       239       249       259   ..280       290       300       310       320       330    ..341       351        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             |  |      |   ||| |              | |  | || || |                    || |||     ^***    |  | ||  |  |     |    ||    ||  ||| | | | ||| ||  | |   |||||||   || |          ..PS00001..  |    |              | |     | | | .. |    | |  |    ||| | |           |  |    |  ||  |       ..      |  |        | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |  |      |   ||| |              | |  ^**| || |                    || |||        |    |  | ||  |  |     |    ||    ||  ||^** | | ^** ||  | |   |||||||   || |          ..PS00005..  |    |              | |     | | | .. |    | |  |    ||| | |           |  |    |  ||  |       ..      |  |        | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             |  |      |   ||| |              | |     | || |                    |^***|        |    |  | ||  |  |     |    ||    ||  ||| | | |  || ||  | |   |||||||   ^***          ..PS00006..  |    |              | |     | | | .. |    | |  |    ||| | |           ^***    |  ||  |       ..      ^***        | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |      ^*****| |              | |     | || |                    |  |||        ^*****  | ||  |  |     ^*****^*****^***** | ^*****| ||  | |   |^*****    | |          ..PS00008..  ^*****              | |     | | | .. ^***** |  |    |^*****                   |  ||  |       ..                  | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |  |          *** |              | |     | || |                    |  |||                ***|  |  |                    ||  | | |  || ||  | |   ||||||     | |          ..asxturn..                      | |     | | | ..        |  |    | | | |                   |  ||  |       ..                  | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |            | |              | |     | || |                    |  |||                |  |  |  |                    **  | | |  || ||  | |   ||||||     | |          ..betabulge..                      | |     | | | ..        |  |    | | | |                   |  ||  |       ..                  | |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..             |  |            | |              | |     | || |                    ******                |  |  |  |                        | | |  || ||  | |   ||||||     | |          ..betabulgeloop..                      | |     | | | ..        |  |    | | | |                   |  ||  |       ..                  | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****            | |              | |     | ****                       |||                |  |  ****                        | | |  *****  | |   ||****     | |          ..betaturn..                      | |     | | | ..        |  |    | | | |                   ********       ..                  | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |            | |              | |     | || |                       |||                |  |  |  |                        | | |   |  |  | |   |||||      | |          ..gammaturn..                      | |     | | | ..        |  |    *** | |                   |  ||  |       ..                  | |
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |            ***              ***     | || |                       ***                |  |  |  |                        | | |   |  |  | |   |||||      ***          ..nest..                      ***     *** | ..        |  |        | |                   |  ||  |       ..                  ***
search RasMol script viewer Motif-ligand binding stats  niche ..             ****                                     ******                        |                 ****  ****                        *****   ****  ***   ****|                   ..niche..                                *** ..        ****        ***                   ********       ..                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                      |                             |                                                                 ***    ||||                   ..stturn..                                    ..                                                         ..                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                      *                             *                                                                        ****                   ..REP00000..                                    ..                                                         ..                     

chain C : PROTEASE DEGS
member of: CATH:search2.30.42.10/search2.40.10.10GENE3D:searchG3DSA_2.30.42.10/searchG3DSA_2.40.10.10PANTHER:searchPTHR22939/searchPTHR22939_SF80PFAM:searchPF00089/searchPF00595PRINTS:searchPROTEASES2CPROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156/searchSSF50494TIGRFAMS:searchTIGR02038UniProt:searchP0AEE3
sec str:  .......hhhhhhhhh..eeeeee..............eeeeeee.....eeeeehhhhh....eeee.....eeeeeeeeee....eeeee......................eeeeee.......eeeeeeeee.........hhhhheee...........eeee....eeeeee....... .....eeeeehhhhhhhhhhhhhhh.......................................ee..ee...hhhhhhhhh......ee........ee.......
sequence :  ..MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFD... ..EGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR..GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPV..LTLQVTIQEYPAT
seq num:  ..42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       ... ..230       240       250       260  ..281       291       301       311       321          ..342          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |      |  |      |    |  | |            | |  | ||  |||||      | |         || |||     ^***    |  | ||  |  |     |    ||    ||  ||| | | | |||  |  | |   |||||||  |||||          ..PS00001.. |    |              | |     | | | ..|    | | ||  |||||   |           |  |    |  |        ..     |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |      |  |      |    |  | |            | |  ^**|  |||||      | |         || |||     | ||    |  | ||  |  |     |    ||    ||  ||^** | | ^**  |  | |   |||||||  |||||          ..PS00005.. |    |              | |     | | | ..|    | | ||  |||||   |           |  |    |  |        ..     |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |      |  |      |    |  | |            | |     |  |||||      | |         |^***|     | ||    |  | ||  |  |     |    ||    ||  ||| | | |  ||  |  | |   |||||||  |^***          ..PS00006.. |    |              | |     | | | ..|    | | ||  |||||   |           ^***    |  |        ..     ^***    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |      |  |      ^*****  | |            | |     |  |||||      | |         |  |||     | |^*****  | ||  |  |     ^*****^*****^***** | ^*****|  |  | |   |^*****  | |||          ..PS00008.. ^*****              | |     | | | ..^***** | ||  |||^*****                   |  |        ..             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |      |  |              | |            | |     |  |||||      | |         |  |||     | |        | ||  |  |                    ||  | | |   |  |  | |   ||||||   | |||          ..alphabetamotif..                     | |     | | | ..       | |*****| |                       |  |        ..             
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |      |  |              | |            | |     |  |||||      ***         |  |||     ***        ***|  |  |                    ||  | | |   |  |  | |   ||||||   | |||          ..asxturn..                     | |     | | | ..       | ||  | | |                       |  |        ..             
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | |      |  |              | |            | |     |  |||||      | |         |  |||                |  |  |  |                    **  | | |   |  |  | |   ||||||   | |||          ..betabulge..                     | |     | | | ..       | ||  | | |                       |  |        ..             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    | |      |  |              | |            | |     |  |||||      | |         ******                |  |  |  |                        | | |   |  |  | |   ||||||   *****          ..betabulgeloop..                     | |     | | | ..       | ||  | | |                       |  |        ..             
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |      |  |              | |            | |     |  |||||      | |            |||                |  |  ****                        | | |   ****  | |   ||****   ****|          ..betaturn..                     | |     | | | ..       | |**** | |                       |  |        ..             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |      |  |              ***            | |     |  |||||      | |            |||                |  |  |  |                        | | |   |  |  | |   |||||      | |          ..gammaturn..                     | |     | *** ..       ***     ***                       |  |        ..             
search RasMol script viewer Motif-ligand binding stats  nest ..    | |      |  |                             ***     |  |****      ***            ***                |  |  |  |                        | | |   |  |  | |   |||||      ***          ..nest..                     ***     ***   ..                                         |  |        ..             
search RasMol script viewer Motif-ligand binding stats  niche ..    | |      ****                                     ****                          |                 ****  ****                        *****   ****  ***   ****|                   ..niche..                                   ..                                         ****        ..             
search RasMol script viewer Motif-ligand binding stats  stturn ..    ***                                               |                             |                                                                 ***    ||||                   ..stturn..                                   ..                                                     ..             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                      *                             *                                                                        ****                   ..REP00000..                                   ..                                                     ..             

   New search    1sot:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors