triangle PDBeMotif: 1so2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.4.17
Classification hydrolase    | release date: Fri, Mar 12, 2004
Title catalytic domain of human phosphodiesterase 3b in complex with a dihydropyridazine inhibitor
Authors A.MASTRACCHIO, C.CHUNG, E.R.PARMEE, G.SCAPIN, J.P.VARNERIN, J.W.BECKER, L.H.VAN DER, M.R.TOTA, PLOEG, S.B.PATEL, S.B.SINGH, S.D.EDMONDSON
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search HG9 HG9 binding statistics HG9   search 666 666 binding statistics 666
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
EQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRD
IPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMA
LYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILAT
DLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPI
SPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPRRKS
RRRIFCQLMHHLTENHKIWK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CGMP-INHIBITED 3',5'-CYCLIC PHOSPHODIESTERASE B
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF29PFAM:searchPF00233PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchQ13370
JMol viewer RasMol script viewer  666 461A  ..                                                                             *                              ..                                               *                                                                                                            * **      *  **                       *          ** **   *                    ..666 ..                     
JMol viewer RasMol script viewer  MG 479A  ..                                                                             |                              ..                                               |                                                                                                            | ||      |  ||               *       |          || ||   |                    ..MG ..                     
JMol viewer RasMol script viewer  MG 472A  ..                                                                             |                              ..                                        *      |                                                                                                            | ||      |  ||               |       |          || ||   |                    ..MG ..                     
JMol viewer RasMol script viewer  MG 471A  ..                                                                             |    *                         ..                                       **      |                                                                                                           *| ||      |  ||               |       |          || ||   |                    ..MG ..                     
sec str:  ....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh...ee...........................eehhhhh.hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhh.....ee..... ......eehhhhhhhhhhhhhhh
sequence :  ..LDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNG..GRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLE... ..SRRRIFCQLMHHLTENHKIWK
seq num:  ..659       669       679       689       699       709       719       729       739       749       759     ..782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002          ... ..1053      1063       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | ||| ||               | |        |   ||||| |||         | || ||      | |        || |||| |  |     |..      |||| |  | ||| || ||             |||| |      |   | |  || | | | ||          | |||| | |  || | |           |  ||| |          | |    | |  |   |              |  |    |   |              | |||    | |  |                      | ||||  |   ..PS00001..| |      |   |       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          | ||| ||               | |        |   ||||| |||         | || ||      | |        || |||| |  |     |..      |||| |  | ||| || ||             |||| |      |   | |  || | | | ||          | |||| | |  || | |           |  ||| |          | |    | |  |   |              |  |    |   |              | |||    | |  |                      | ||||  |   ..PS00004..* |      |   |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | ||| ||               ^**        |   ||||| |||         | || ||      | |        || |^** |  |     |..      ^**| |  | ||| || ||             |||| |      |   | |  || | | | ||          | |||| | |  || | |           |  ||| |          | |    | |  |   |              |  |    |   |              | |||    | |  |                      | ||||  |   ..PS00005..^**      |   |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          ^***| ||                          |   ||||| |||         | || ||      | |        || |||| |  |     |..       | | ^*** ||| || ||             |||| |      |   | |  || | | ^***          | ^*** | |  || | |           |  ||| |          | |    | |  |   |              |  |    |   |              | |||    | |  |                      | ||||  |   ..PS00006..         |   |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            | | ||                          |   ||||| |||         ******^      | |        || |||| |  |     |..       | |    | ||| || ||             |||| |      |   | |  || | | | |           |  ||  | |  || | |           |  ||| |          | |    | |  |   |              |  |    |   |              | |||    | |  |                      | ||||  |   ..PS00007..         |   |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | | ||                          |   ||||| |||           || ||      | |        || |||| |  |     ^..       | |    | ||^*****|             |||| |      |   | |  || | | | |           |  ||  | |  || | |           |  ||| |          | |    ^*****   |              |  |    |   |              | |||    | |  |                      | |^*****   ..PS00008..         |   |       
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..            | | ||                          |   ||||| |||           || ||      | |        || |||| |  |      ..       | |    | ||| || ||             |************   | |  || | | | |           |  ||  | |  || | |           |  ||| |          | |      |  |   |              |  |    |   |              | |||    | |  |                      | ||||      ..PS00126..         |   |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | ||                          |   ||||| |||           || ||      | |        || |||| |  |      ..       | |    | ||| *****             | || |      |   | ***** | | | |           |  ||  | |  || | |           |  ||| |          | |      |  |   |              |  |    |   |              | |||    | |  |                      | ||||      ..alphabetamotif..         |   |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            | | ||                          |   ||||| |||           || ||      | |        || |||| |  |      ..       | |    ***** || ||             | || |      |   | |  |  | | | |           |  ||  | |  |*****           |  ||| |          | |      |  *****              |  |    |   |              | |||    | |  |                      | ||||      ..asxmotif..         |   |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | | ||                          |   ||||| |||           || ||      ***        || |||| |  |      ..       | |    ***|  || ||             | || |      |   | |  |  | | | |           |  ||  | |  |***             |  *** |          | |      |  |                  |  |    |   |              | |||    | |  |                      | ||||      ..asxturn..         |   |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | ||                          |   ||||****|           *****                 || |||| |  |      ..       | |    ****  ****|             | ****      |   | ****  | | | |           |  |**** |  |                |  |****          | |      ****                  |  |    |   |              ****|    | ****                      ****||      ..betaturn..         |   |       
search RasMol script viewer Motif-ligand binding stats  nest ..            | | ||                          |   ****  ***            |  |                 || |||| |  |      ..       | |    |  |   |  |             | || |      |   ***     *** ***           |  |     |  |                |  |              | |      |  |                  |  |    |   |                ***    ***                           ****      ..nest..         |   |       
search RasMol script viewer Motif-ligand binding stats  niche ..            | ****                          |   |  |    |            ****                 || **** ****      ..       | |    ****   ****             ******      |   |                         ****     ****                ****              ***      ****                  ****    |   |                       ***                            ***      ..niche..         |   |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |   |                           |   |  ******                                 ||  ||            ..       | |                                        |   |                                                                                                               |   |                                                               ..schellmannloop..         |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                           *****                                         ******            ..       | |                                        *****                                                                                                               *****                                                               ..ststaple..         *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                            ..       ***                                                                                                                                                                                                                                ..stturn..                     

chain B : CGMP-INHIBITED 3',5'-CYCLIC PHOSPHODIESTERASE B
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF29PFAM:searchPF00233PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchQ13370
JMol viewer RasMol script viewer  666 462B  ..                                                                             *                              ..                                               *                                                                 *                                          * **      *  **                       *          ** **   *                    ..666 ..                     
JMol viewer RasMol script viewer  HG9 452B  ..                                                                             |                              ..                                               |                                                                 |                                          | ||      |  ||                       |        * || ||   |                    ..HG9 ..                 ** *
JMol viewer RasMol script viewer  HG9 451B  ..                                                                             |                              ..                                               |                                                                 |                                          | ||      |  ||*  **                  |  *    *| || ||   |                    ..HG9 ..                 || |
JMol viewer RasMol script viewer  MG 474B  ..                                                                             |                              ..                                        *      |                                                                 |                                          | ||      |  |||  ||                  |  |    || || ||   |                    ..MG ..                 || |
JMol viewer RasMol script viewer  MG 473B  ..                                                                             |    *                         ..                                       **      |                                                                 |                                         *| ||      |  |||  ||                  |  |    || || ||   |                    ..MG ..                 || |
sec str:  ......hhhhhhhhhhhhh....hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.ee...........................eehhhhh.hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhh.....ee..... ......eehhhhhhhhhhhhhhh
sequence :  ..LDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNG..GRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLE... ..SRRRIFCQLMHHLTENHKIWK
seq num:  ..659       669       679       689       699       709       719       729       739       749       759     ..782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002          ... ..1053      1063       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |  |  | ||| ||         | || || |        |   ||||  | |         |  |  |      |||  |     |  || | |  |     |..      |||| |  | ||| || ||             |||| |   |  ||  | |  || | | | ||         || |||| | |  ||   |           |  |                     | |  | |               || ||    |   |              | |||    | |  |                      | ||||  |   ..PS00001..||||                 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | |  |  | ||| ||         | || || |        |   ||||  | |         |  |  |      |||  |     |  || | |  |     |..      |||| |  | ||| || ||             |||| |   |  ||  | |  || | | | ||         || |||| | |  ||   |           |  |                     | |  | |               || ||    |   |              | |||    | |  |                      | ||||  |   ..PS00004..*|||                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  |  | ||| ||         | || |^**        |   ||||  | |         |  |  |      |||  |     |  |^** |  |     |..      ^**| |  | ||| || ||             |||| |   |  ||  | |  || | | | ||         || |||| | |  ||   |           |  |                     | |  | |               || ||    |   |              | |||    | |  |                      | ||||  |   ..PS00005..^**|                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |  |  ^***| ||         | || |           |   ||||  | |         |  |  |      |||  |     |  || | |  |     |..       | | ^*** ||| || ||             |||| |   |  ||  | |  || | | ^***         || ^*** | |  ||   |           |  |                     | |  | |               || ||    |   |              | |||    | |  |                      | ||||  |   ..PS00006.. | |                 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | |  |  | | | ||         | || |           |   ||||  | |         ******^      |||  |     |  || | |  |     |..       | |    | ||| || ||             |||| |   |  ||  | |  || | | | |          || |||  | |  ||   |           |  |                     | |  | |               || ||    |   |              | |||    | |  |                      | ||||  |   ..PS00007.. | |                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |  |  | | | ||         | || |           |   ||||  | |            |  |      |||  |     |  || | |  |     ^..       | |    | ||^*****|             |||| |   |  ||  | |  || | | | |          || |||  | |  ||   |           |  |                     ^***** |               || ||    |   |              | |||    | |  |                      | |^*****   ..PS00008.. | |                 
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..  | |  |  | | | ||         | || |           |   ||||  | |            |  |      |||  |     |  || | |  |      ..       | |    | ||| || ||             |************|  | |  || | | | |          || |||  | |  ||   |           |  |                       |  | |               || ||    |   |              | |||    | |  |                      | ||||      ..PS00126.. | |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |  |  | | | ||         | || |           |   ||||  | |            |  |      |||  |     |  || | |  |      ..       | |    | ||| *****             | || |   |  ||  | ***** | | | |          || |||  | |  ||   |           |  |                       |  | |               || ||    |   |              | |||    | |  |                      | ||||      ..alphabetamotif.. | |                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |  |  | | | ||         | || |           |   ||||  | |            |  |      |||  |     |  || | |  |      ..       | |    ***** || ||             | || |   |  ||  | |  |  | | | |          || |||  | |  |*****           |  |                       |  | |               || ||    |   |              | |||    | |  |                      | ||||      ..asxmotif.. | |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |  |  | | | ||         | || |           |   ||||  | |            |  |      ***  |     |  || | |  |      ..       | |    ***|  || ||             | || |   |  ||  | |  |  | | | |          || |||  | |  |                |  |                       |  ***               || ||    |   |              | |||    | |  |                      | ||||      ..asxturn.. | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |  **** | | ||         ******           |   ||||  | |            ****       |   |     |  || | |  |      ..       | |    ****  ****|             | ****   |  ||  | ****  | | | |          ****|**** |  |                |  |                       ****                 ****|    |   |              ****|    | ****                      ****||      ..betaturn.. | |                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***       | | ||                          |   ||||  | |            |  |       |   |     |  || | |  |      ..       | |    |  |   |  |             | || |   |  ||  | |     | | | |           |  |     |  |                |  |                       |  |                  |  |    |   |                | |    | |                           ||||      ..gammaturn.. ***                 
search RasMol script viewer Motif-ligand binding stats  nest ..            | | ||                          |   ****  ***            |  |       |   |     |  || | |  |      ..       | |    |  |   |  |             | || |   |  ||  ***     *** ***           |  |     |  |                |  |                       |  |                  |  |    |   |                ***    ***                           ****      ..nest..                     
search RasMol script viewer Motif-ligand binding stats  niche ..            | ****                          |   |                    ****       |   |     |  **** ****      ..       | |    ****   ****             ******   |  ||  |                         ****     ****                ****                       ****                  ****    |   |                       ***                            ***      ..niche..                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..            |   |                           |   |                               |   |     |   |             ..       | |                                     *****  |                                                                                                               |   |                                                               ..stmotif..                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                           *****                               *****     *****             ..       | |                                        *****                                                                                                               *****                                                               ..ststaple..                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                            ..       ***                                                                                                                                                                                                                                ..stturn..                     

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : CGMP-INHIBITED 3',5'-CYCLIC PHOSPHODIESTERASE B
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF29PFAM:searchPF00233PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchQ13370
JMol viewer RasMol script viewer  666 463C  ..                                                                             *                               ..                                                       *                                                                 *                                          * **      *  **  *   *                           ** **                        ..666 ..                     
JMol viewer RasMol script viewer  MG 476C  ..                                                                             |                               ..                                                *      |                                                                 |                                          | ||      |  ||  |   |                           || ||                        ..MG ..                     
JMol viewer RasMol script viewer  MG 475C  ..                                                                             |                               ..                                                *      |                                                                 |                                         *| ||      |  ||  |   |                           || ||                        ..MG ..                     
JMol viewer RasMol script viewer  HG9 454A  ..                                                                             |                               ..                                                |      |                                                                 |                                         || ||      |  ||* | * |                   *       || ||                        ..HG9 ..                     
sec str:  .....hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.ee....................................eehhhhh.hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhh.....ee..... ......eehhhhhhhhhhhhhhh
sequence :  ..LDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGC..DSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLE... ..SRRRIFCQLMHHLTENHKIWK
seq num:  ..659       669       679       689       699       709       719       729       739       749       759      ..774       784       794       804       814       824       834       844       854       864       874       884       894       904       914       924       934       944       954       964       974       984       994       1004        ... ..1053      1063       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |    | ||| ||               | |   |   ||   ||||| |||         | || ||    | ||   |     |  || | |  |     | ..* | | |  |    | |  |  | ||| || ||          |  |||| |      |  || || |||||||| || |   |   || |||| | |  |                |  ||| |              | || |  | |               || ||    |   |           | ||||||  | |||                        || ||||  |   ..PS00001..| |    | ||| ||  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |    | ||| ||               | |   |   ||   ||||| |||         | || ||    | ||   |     |  || | |  |     | ..  | | |  |    | |  |  | ||| || ||          |  |||| |      |  || || |||||||| || |   |   || |||| | |  |                |  ||| |              | || |  | |               || ||    |   |           | ||||||  | |||                        || ||||  |   ..PS00004..* |    | ||| ||  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |    | ||| ||               ^**   |   ||   ||||| |||         | || ||    | ||   |     |  |^** |  |     | ..  | | |  |    ^**  |  | ||| || ||          |  |||| |      |  || || |||||||| || |   |   || |||| | |  |                |  ||| |              | || |  | |               || ||    |   |           | ||||||  | |||                        || ||||  |   ..PS00005..^**    | ||| ||  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |    ^***| ||                     |   ||   ||||| |||         | || ||    | ||   |     |  || | |  |     | ..*** | |  |         ^*** ||| || ||          |  |||| |      |  || || |||||||^*** |   |   || ^*** | |  |                |  ||| |              | || |  | |               || ||    |   |           | ||||||  | |||                        || ||||  |   ..PS00006..       | ||| ||  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |      | | ||                     |   ||   ||||| |||         ******^    | ||   |     |  || | |  |     | ..  | | |  |            | ||| || ||          |  |||| |      |  || || |||||||| |  |   |   || |||  | |  |                |  ||| |              | || |  | |               || ||    |   |           | ||||||  | |||                        || ||||  |   ..PS00007..       | ||| ||  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |      | | ||                     |   ||   ||||| |||           || ||    | ||   |     |  || | |  |     ^*..  | | |  |            | ||^*****|          |  |||| |      |  || || |||||||| |  |   |   || |||  | |  |                |  ||| |              | |^***** |               || ||    |   |           | ||||||  | |||                        || |^*****   ..PS00008..       | ||| ||  |   
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..   | |      | | ||                     |   ||   ||||| |||           || ||    | ||   |     |  || | |  |       ..  | | |  |            | ||| || ||          |  |************  || || |||||||| |  |   |   || |||  | |  |                |  ||| |              | |  |  | |               || ||    |   |           | ||||||  | |||                        || ||||      ..PS00126..       | ||| ||  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |      | | ||                     |   ||   ||||| |||           || ||    | ||   |     |  || | |  |       ..  | | |  |            | ||| *****          *****|| |      ***** ******||||| |  |   |   || |||  | |  |                |  ||| |              | |  |  | |               || ||    |   |           *****|||  | |||                        || ||||      ..alphabetamotif..       ***** ||  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |      | | ||                     |   ||   ||||| |||           || ||    | ||   |     |  || | |  |       ..  | | |  |            ***** || ||          |  | || |      |  || || || ||||| |  |   |   || |||  | |  |                |  ||| |              | |  |  | |               || ||    |   |           | || |||  | |||                        || ||||      ..asxmotif..       | ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |      | | ||                     |   ||   ||||| |||           || ||    | ||   |     |  || | |  |       ..  | | |  |            ***|  || ||          |  | || |      |  || || || ||||| |  |   |   || |||  | |  |                |  *** |              | |  |  ***               || ||    |   |           | || |||  | |||                        || ||||      ..asxturn..       | ||  ||  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |      | | ||                     |   ||   ||||****|           *****    | ||   |     |  || | |  |       ..  | | |  |            ****  ****|          **** ****      ****| **********| |  |   |   ****||  | |  |                |  |****              | |  ****                 ****|    |   |           *******|  ****|                        |****||      ..betaturn..       ****  |****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |      | | ||                     |   ||   ||||  | |            |  |    ***|   |     |  || | |  |       ..  | | |  |            |  |   |  |             | || |          | |  |  | | | |  |   |    |  ||  | |  |                |  |                  ***  |  |                  |  |    |   |             |  | |    | |                        |  ||||      ..gammaturn..         |   |       
search RasMol script viewer Motif-ligand binding stats  nest ..   ***      | | ||                     |   ||   ****  ***            |  |       |   |     |  || | |  |       ..  *** |  |            |  |   |  |             | || |          ***  |  *** ***  |   |    |  ||  | |  |                |  |                       |  |                  |  |    |   |             |  ***    ***                        |  ****      ..nest..         |   |       
search RasMol script viewer Motif-ligand binding stats  niche ..            | ****                     |   ||   |  |    |            ****       |   |     |  **** ****       ..      ****            ****   ****             ******               |    |      |   |    ******** ****                ****                       ****                  ****    |   |             |    |    ***                        |   ***      ..niche..         |   |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |   |                      |   ||   |  ******                       |   |     |   |              ..                                                                   ******      |   |                                                                                          |   |             ******                               ******       ..schellmannloop..         |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                      **********                               *****     *****              ..                                                                               *****                                                                                          *****                                                               ..ststaple..         *****       

chain D : CGMP-INHIBITED 3',5'-CYCLIC PHOSPHODIESTERASE B
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF29PFAM:searchPF00233PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchQ13370
JMol viewer RasMol script viewer  666 464D  ..                                                                             *                              ..                                                 *                                                                                                            * **      *  **                       *          ** **                          ..666 ..                   
JMol viewer RasMol script viewer  MG 478D  ..                                                                             |                              ..                                          *      |                                                                                                            | ||      |  ||                       |          || ||                          ..MG ..                   
JMol viewer RasMol script viewer  MG 477D  ..                                                                             |    *                         ..                                          *      |                                                                                                           *| ||      |  ||                       |          || ||                          ..MG ..                   
sec str:  ....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh...................................hhhhh.hhhhhhhhhhhhh.........hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhh.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhh....ee....... ....eehhhhhhhhhhhhhhh
sequence :  ..LDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNG..NHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAE... ..RRIFCQLMHHLTENHKIWK
seq num:  ..659       669       679       689       699       709       719       729       739       749       759     ..780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990       1000      1010    ... ..1055      1065     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | ||| ||           |  || |        |   ||||| |||         | || ||    | |   |      |  || | |  |   | |..        ||||||  | ||| || ||          |  |||| |      ||| |||  || ||| | ||         || |||| | |  ||  ||  ||      || |||| |     |  ||    | || |  |                 |  |||  ||   |              | |||  | ||| |                       | ||||  |     ..PS00001..|                  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          | ||| ||           |  || |        |   ||||| |||         | || ||    | |   |      |  || | |  |   | |..        ||||||  | ||| || ||          |  |||| |      ||| |||  || ||| | ||         || |||| | |  ||  ||  ||      || |||| |     |  ||    | || |  |                 |  |||  ||   |              | |||  | ||| |                       | ||||  |     ..PS00004..|                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | ||| ||           |  |^**        |   ||||| |||         | || ||    | |   |      |  |^** |  |   | |..        ^**|||  | ||| || ||          |  |||| |      ||| |||  || ||| | ||         || |||| | |  ||  ||  ||      || |||| |     |  ||    | || |  |                 |  |||  ||   |              | |||  | ||| |                       | ||||  |     ..PS00005..*                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          ^***| ||           |  |           |   ||||| |||         | || ||    | |   |      |  || | |  |   | |..         | ||^*** ||| || ||          |  |||| |      ||| |||  || ||| ^***         || ^*** | |  ||  ||  ||      || |||| |     |  ||    | || |  |                 |  |||  ||   |              | |||  | ||| |                       | ||||  |     ..PS00006..                   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            | | ||           |  |           |   ||||| |||         ******^    | |   |      |  || | |  |   | |..         | ||   | ||| || ||          |  |||| |      ||| |||  || ||| | |          || |||  | |  ||  ||  ||      || |||| |     |  ||    | || |  |                 |  |||  ||   |              | |||  | ||| |                       | ||||  |     ..PS00007..                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | | ||           |  |           |   ||||| |||           || ||    | |   |      |  || | |  |   | ^..         | ||   | ||^*****|          |  |||| |      ||| |||  || ||| | |          || |||  | |  ||  ||  ||      || |||| |     |  ||    | |^*****                 |  |||  ||   |              | |||  | ||| |                       | |^*****     ..PS00008..                   
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..            | | ||           |  |           |   ||||| |||           || ||    | |   |      |  || | |  |   | |..         | ||   | ||  || ||          |  |************|| |||  || ||| | |          || |||  | |  ||  ||  ||      || |||| |     |  ||    | |  |  |                 |  |||  ||   |              | |||  | ||| |                       | ||||        ..PS00126..                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | ||           |  |           |   ||||| |||           || ||    | |   |      |  || | |  |   | |..         | ||   | ||  || ||          *****|| |       || ||***** ||| | |          || |||  | |  |*********      || |||| |     *****    | |  |  |                 *****|  ||   |              | |||  | ||| |                       | ||||        ..alphabetamotif..                   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            | | ||           |  |           |   ||||| |||           || ||    | *****      |  || | |  |   | |..         | ||   | ||  || ||          |  | || |       || |||  || ||| | |          || |||  | |  ||  ||  |       || |||| |     |  |     | |  |  |                 |  | |  ||   |              | |||  | ||| |                       | ||||        ..asxmotif..                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | | ||           |  |           |   ||||| |||           || ||    | |          |  || | |  |   | |..         | ||   ***|  || ||          |  | || |       || |||  || ||| | |          || |||  | |  ||  ||  |       || |*** |     |  |     | |  |  |                 |  | |  ||   |              | |||  | ||***                       | ||||        ..asxturn..                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | ||           ****           |   |*******|           *****    | |          |  || | ****   | |..         | ||   |  |  ****|          **** ****       |************| | |          ****|**** |  |********       ****|****     ****     | |  ****                 **** ****|   |              ****|  ****|                         ****||        ..betaturn..                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | | ||                          |   ||||  | |            |  |    ***          |  || | |  |   | |..         | ||   |  |   |  |             | || |       |  | |  |  | | | |           |  ||  | |  |                |  |                  ***  |  |                          |   |                | |    | |                           ||||        ..gammaturn..                   
search RasMol script viewer Motif-ligand binding stats  nest ..            | | ||                          |   ****  ***            |  |                 |  || | |  |   ***..         | ||   |  |   |  |             | || |       |  ***  |  *** ***           |  ||  | |  |                |  |                       |  |                          |   |                ***    ***                           ****        ..nest..                   
search RasMol script viewer Motif-ligand binding stats  niche ..            | ****                          |   |  |    |            ****                 |  **** ****      ..         ****   ****   ****             ******       |    |  |    |               ******** ****                ****                       ****                          |   |                       ***                            ***        ..niche..                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |   |                           |   |  ******                                 |   |             ..         | |                                         ******  ******                                                                                                     |   |                                                                 ..schellmannloop..                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                           *****                                         *****             ..         | |                                                                                                                                                            *****                                                                 ..ststaple..                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                            ..         ***                                                                                                                                                                                                                                  ..stturn..                   

   New search    1so2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors