triangle PDBeMotif: 1sn8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.4.
Classification hydrolase    | release date: Wed, Mar 10, 2004
Title crystal structure of the s1 domain of rnase e from e. coli (pb derivative)
Authors G.A.MACKIE, L.P.MCINTOSH, M.A.COOK, M.SCHUBERT, N.C.J.STRYNADKA, P.LARIO, R.E.EDGE
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search PB PB binding statistics PB
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEER
GNKGAALTTFISLAGS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RIBONUCLEASE E
member of: CATH:search2.40.50.140GENE3D:searchG3DSA_2.40.50.140HAMAP:searchMF_00970PANTHER:searchPTHR30001/searchPTHR30001_SF1PFAM:searchPF00575/searchPF10150PROSITE PROFILES:searchPS50126, SMART:searchSM00316SUPERFAMILY:searchSSF50249TIGRFAMS:searchTIGR00757UniProt:searchP21513
JMol viewer RasMol script viewer  PB 605A  ..                                 *                                                     
JMol viewer RasMol script viewer  PB 604A  ..                                 |            *                                        
sec str:  .....eeeeeeeeehhh.eeeee......eeee.hhhhhhhh..........hhhhh.....eeeeeeee........eee........
sequence :  ..ANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
seq num:  ..39        49        59        69        79        89        99        109       119    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  |  | |   |||| |    || || |  |  ^***|   ||||| |  |      ||   | |  | | |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***  | |   |||| |    || || |  |    | |   ||||| |  |      ||   | |  | | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  | |   |||| |    || || |  |    | |   ||||| |  |      ||   ^***** | |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |  | |   |||| |    || || |  |    | |   ***** |  |      ||   | |    | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  | |   ***| |    || || |  |    | |   ***|| |  |      ||   | |    | |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  | |    | | |    || || |  |    | |   || || |  |      **   | |    | |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           ******    | | |    || || |  |    | |   || || |  |           | |    | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |    | | |    ****| ****    | |   ***** |  |           | |    | |      
search RasMol script viewer Motif-ligand binding stats  nest ..              ***    *** |     |  | |  |    | |         |  |           | |    | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                       ***     **** ****    | |         ****           ***    ***      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                            ***                                        

chain B : RIBONUCLEASE E
member of: CATH:search2.40.50.140GENE3D:searchG3DSA_2.40.50.140HAMAP:searchMF_00970PANTHER:searchPTHR30001/searchPTHR30001_SF1PFAM:searchPF00575/searchPF10150PROSITE PROFILES:searchPS50126, SMART:searchSM00316SUPERFAMILY:searchSSF50249TIGRFAMS:searchTIGR00757UniProt:searchP21513
sec str:  .....eeeeeeeeehhh.eeeee......eeee.hhhhhhhh.....hhhhhh....eeeeeeee........eee........
sequence :  ..ANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPA..PNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
seq num:  ..39        49        59        69          ..88        98        108       118     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  || |||   |||| |    || || |  |  ..       |  |      ||  || |  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        ^***| |||   |||| |    || || |  |  ..       |  |      ||  || |  |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           || |||   |||| |    || || |  |  ..       |  |      ||  |^*****          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           || |||   ***| |    || || |  |  ..       |  |      ||  || |             
search RasMol script viewer Motif-ligand binding stats  betabulge ..           || |||    | | |    || || |  |  ..       |  |      **  || |             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           ******    | | |    || || |  |  ..       |  |          || |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****|    | | |    ****| ****  ..       |  |          ****             
search RasMol script viewer Motif-ligand binding stats  nest ..              ***    *** |     |  | |  |  ..       |  |           | |             
search RasMol script viewer Motif-ligand binding stats  niche ..                       ***     **** ****  ..       ****           ***             

   New search    1sn8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors